Cannabinoid R1/CB1/CNR1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Cannabinoid R1/CB1/CNR1 Antibody - BSA Free (NBP3-17650) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CNR1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cannabinoid R1/CB1/CNR1 Antibody - BSA Free
Background
CB1 Cannabinoid receptor is associated with the regulation of cognition, memory, and motor activity. The CB1 receptor mediates cannabinoid-induced CNS effects and the addictive behavior experienced by users of marijuana. Three splice variants that are produced by alternative splicing have been identified for this gene. CB1 has been reported primarily in the brain and, to a lower extent, in peripheral tissues including adrenal, heart, lung, prostate, uterus, ovary, testis, bone marrow, thymus, and tonsil. ESTs have been isolated from brain, embryo, heart/melanocyte/uterus, lung, placenta, testis, tonsil, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Pm, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC
Publications for Cannabinoid R1/CB1/CNR1 Antibody (NBP3-17650) (0)
There are no publications for Cannabinoid R1/CB1/CNR1 Antibody (NBP3-17650).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cannabinoid R1/CB1/CNR1 Antibody (NBP3-17650) (0)
There are no reviews for Cannabinoid R1/CB1/CNR1 Antibody (NBP3-17650).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Cannabinoid R1/CB1/CNR1 Antibody (NBP3-17650) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cannabinoid R1/CB1/CNR1 Products
Research Areas for Cannabinoid R1/CB1/CNR1 Antibody (NBP3-17650)
Find related products by research area.
|
Blogs on Cannabinoid R1/CB1/CNR1