CAMP/Cathelicidin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CAMP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CAMP/Cathelicidin Antibody - BSA Free
Background
Cathelicidins are a family of antimicrobial proteins predominantly found in the peroxidase negative granules of neutrophils. The cathelicidins are synthesized as preproproteins. Within the neutrophils, they are stored in granules as inactive proforms after removal of the signal peptide. The active biologic domains of the cathelicidins generally reside in the C terminus. The C terminal antimicrobial peptides are activated when cleaved from the proforms of the cathelicidins by serine proteases from azurophil granules. FUNCTION: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. SUBCELLULAR LOCATION: Secreted. TISSUE SPECIFICITY: Expressed in bone marrow and testis and neutrophils.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ba, Hu, Mu, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB, IHC
Publications for CAMP/Cathelicidin Antibody (NBP1-88203) (0)
There are no publications for CAMP/Cathelicidin Antibody (NBP1-88203).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CAMP/Cathelicidin Antibody (NBP1-88203) (0)
There are no reviews for CAMP/Cathelicidin Antibody (NBP1-88203).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CAMP/Cathelicidin Antibody (NBP1-88203) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CAMP/Cathelicidin Products
Blogs on CAMP/Cathelicidin