CaMKV Antibody

Images

 
Western Blot: CaMKV Antibody [NBP1-56677] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CaMKV Antibody Summary

Immunogen
Synthetic peptides corresponding to CAMKV(CaM kinase-like vesicle-associated) The peptide sequence was selected from the N terminal of CAMKV. Peptide sequence NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAMKV
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CAMKV and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CaMKV Antibody

  • 1G5
  • caM kinase-like vesicle-associated protein
  • CaM kinase-like vesicle-associated
  • MGC8407
  • VACAMKL
  • vesicle-associated calmodulin-binding protein

Background

CAMKV does not appear to have detectable kinase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24567
Species: Hu
Applications: WB
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF937
Species: Mu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13405
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-56677
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for CaMKV Antibody (NBP1-56677) (0)

There are no publications for CaMKV Antibody (NBP1-56677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CaMKV Antibody (NBP1-56677) (0)

There are no reviews for CaMKV Antibody (NBP1-56677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CaMKV Antibody (NBP1-56677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CaMKV Products

Bioinformatics Tool for CaMKV Antibody (NBP1-56677)

Discover related pathways, diseases and genes to CaMKV Antibody (NBP1-56677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CaMKV Antibody (NBP1-56677)

Discover more about diseases related to CaMKV Antibody (NBP1-56677).

Research Areas for CaMKV Antibody (NBP1-56677)

Find related products by research area.

Blogs on CaMKV

There are no specific blogs for CaMKV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CaMKV Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMKV
Uniprot