CaMKK2 Antibody - BSA Free

Western Blot: CaMKK2 Antibody [NBP3-38627] - Western blot analysis of various lysates using CaMKK2 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: CaMKK2 Antibody [NBP3-38627] - Immunofluorescence analysis of PC-3 cells using CaMKK2 Rabbit pAb at dilution of 1:25 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CaMKK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CaMKK2 Antibody - BSA Free (NBP3-38627) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CaMKK2 (NP_006540.3).
  
  Sequence:
  MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMKK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:100 - 1:500
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CaMKK2 Antibody - BSA Free

• calcium/calmodulin-dependent protein kinase kinase 2
• calcium/calmodulin-dependent protein kinase kinase 2, beta
• Calcium/calmodulin-dependent protein kinase kinase beta
• CaM-kinase kinase 2
• CaM-kinase kinase beta
• CaMKK 2
• CaM-KK 2
• CAMKK beta protein
• CaMKK beta
• CaM-KK beta
• CAMKK
• CaMKK2
• CAMKKB
• CAMKKBCaMKK 2
• EC 2.7.11
• EC 2.7.11.17
• KIAA0787
• KIAA0787calcium/calmodulin-dependent protein kinase beta
• MGC15254

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMKK2