CaMKK2 Antibody - BSA Free

Western Blot: CaMKK2 Antibody [NBP3-17692] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

Immunohistochemistry-Paraffin: CaMKK2 Antibody [NBP3-17692] - Staining of human cerebellum shows cytoplasmic positivity in dentate nucleus.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CaMKK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CaMKK2 Antibody - BSA Free (NBP3-17692) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMKK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CaMKK2 Antibody - BSA Free

• calcium/calmodulin-dependent protein kinase kinase 2
• calcium/calmodulin-dependent protein kinase kinase 2, beta
• Calcium/calmodulin-dependent protein kinase kinase beta
• CaM-kinase kinase 2
• CaM-kinase kinase beta
• CaMKK 2
• CaM-KK 2
• CAMKK beta protein
• CaMKK beta
• CaM-KK beta
• CAMKK
• CaMKK2
• CAMKKB
• CAMKKBCaMKK 2
• EC 2.7.11
• EC 2.7.11.17
• KIAA0787
• KIAA0787calcium/calmodulin-dependent protein kinase beta
• MGC15254

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMKK2