Calnexin Antibody - BSA Free

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human cerebral cortex, placenta, testis and tonsil using Anti-Calnexin antibody NBP1-85520 (A) shows similar protein distribution across tissues to independent antibody NBP1-85519 (B).

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calnexin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calnexin Antibody - BSA Free (NBP1-85520) is a polyclonal antibody validated for use in IHC. Anti-Calnexin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI
• Marker: Endoplasmic Reticulum Membrane Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CANX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Calnexin Protein (NBP1-85520PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%). Reactivity reported in scientific literature (PMID: 22361696)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Calnexin Antibody - BSA Free

• calnexin
• CNX
• IP90FLJ26570
• Major histocompatibility complex class I antigen-binding protein p88
• P90

Background

Calnexin, an abundant approx. 90kDa integral protein of the endoplasmic reticulum, is also referred to as IP90, p88 and p90 (1). It consists of a large 50kDa N-terminal calcium-binding luminal domain, a single transmembrane helix and a short acidic cytoplasmic tail (2, 3). Unlike its ER counterparts which have a KDEL sequence on their Cterminus to ensure ER retention (4), calnexin has positively charged cytosolic residues that do the same thing (3). Most ER proteins act as molecular chaperones and participate in the proper folding of polypeptides and their assembly into mulit-subunit proteins. Calnexin together with calreticulin, plays a key role in glycoprotein folding and its control within the ER, by interacting with folding intermediates via their monoglycosylated glycans (5, 6). Calnexin has also been shown to associate with the major histocompatability complex class I heavy chains, partial complexes of the T cell receptor and B cell membrane immunoglobulin (7).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calnexin Antibody (NBP1-85520)(1)

Publication using NBP1-85520

• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]

Bioinformatics

• Gene Symbol: CANX