Calnexin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Calnexin Antibody [NBP1-85519] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85519] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calnexin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRR
Marker
Endoplasmic Reticulum Membrane Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CANX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Calnexin Protein (NBP1-85519PEP)
Publications
Read Publications using
NBP1-85519 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calnexin Antibody

  • calnexin
  • CNX
  • IP90FLJ26570
  • Major histocompatibility complex class I antigen-binding protein p88
  • P90

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-85519
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Calnexin Antibody (NBP1-85519)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Calnexin Antibody (NBP1-85519) (0)

There are no reviews for Calnexin Antibody (NBP1-85519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Calnexin Antibody (NBP1-85519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calnexin Products

Bioinformatics Tool for Calnexin Antibody (NBP1-85519)

Discover related pathways, diseases and genes to Calnexin Antibody (NBP1-85519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calnexin Antibody (NBP1-85519)

Discover more about diseases related to Calnexin Antibody (NBP1-85519).
 

Pathways for Calnexin Antibody (NBP1-85519)

View related products by pathway.

Research Areas for Calnexin Antibody (NBP1-85519)

Find related products by research area.

Blogs on Calnexin.

Calnexin - an ER chaperone that folds the cell's glycoproteins
Calnexin is an abundant 90kDa chaperone protein that resides in the membrane of the endoplasmic reticulum. Calnexin and the related calreticulin protein function together to ensure the proper folding of glycoproteins. By binding to partially folded...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calnexin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CANX
Entrez
Uniprot