Calmodulin Antibody (10W3Y7)

Images

 
Western Blot: Calmodulin Antibody (10W3Y7) [NBP3-16500] - Western blot analysis of extracts of various cell lines, using Calmodulin Rabbit mAb (NBP3-16500) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit ...read more
Immunocytochemistry/ Immunofluorescence: Calmodulin Antibody (10W3Y7) [NBP3-16500] - Confocal imaging of paraffin-embedded Rat brain using Calmodulin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit ...read more
Immunocytochemistry/ Immunofluorescence: Calmodulin Antibody (10W3Y7) [Calmodulin] - Confocal imaging of paraffin-embedded Mouse brain using Calmodulin Rabbit mAb followed by a further incubation with Cy3 Goat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
10W3Y7
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calmodulin Antibody (10W3Y7) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1). LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Source
HEK293
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
CALM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:6000
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Calmodulin Antibody (10W3Y7)

  • CALM
  • CALM1
  • CALM2
  • CALM3
  • CALML2
  • calmodulin 1 (phosphorylase kinase, delta)
  • Calmodulin 1
  • calmodulin
  • CaM
  • CAM1
  • CAM2
  • CAM3
  • CAMB
  • CAMC
  • CAMI
  • CAMIII
  • CPVT4
  • DD132
  • PHKDCAM
  • phosphorylase kinase, delta subunit

Background

Calmoduin (CaM) is a calcium modulator protein and a transducer of calcium signals (1-2). Upon calcium binding, calmodulin undergoes conformational changes and binds and modulates a diverse array of proteins. Calcium-bound CaM (Ca2+-CaM) can assume a variety of shapes depending on the target (3). Ca2+-CaM binds many kinases, phosphatases, signaling proteins, and structural proteins affecting a wide variety of processes including neurotransmitter release, muscle contraction, metabolism, apoptosis, inflammation, membrane protein organization, and cytoskeleton movement (2, 4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-39681
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC,  IHC-P, IP, WB
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
DVE00
Species: Hu
Applications: ELISA
AF7947
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-62682
Species: Hu
Applications: IHC,  IHC-P
NBP2-32489
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
233-FB
Species: Hu
Applications: BA
NBP3-16500
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC

Publications for Calmodulin Antibody (NBP3-16500) (0)

There are no publications for Calmodulin Antibody (NBP3-16500).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calmodulin Antibody (NBP3-16500) (0)

There are no reviews for Calmodulin Antibody (NBP3-16500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calmodulin Antibody (NBP3-16500). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody that can bind an engineered calmodulin domain of a fluorescent biosensor. Can you provide me the amino acid sequence that your calmodulin antibodies were raised against so that I can compare them to the sequence I am working with? Can you please provide your sequence identity for this fragment: D Q L T E E Q I A E F K E A F S L F D K D G D G T I T T K E L G T V M R S L G Q N P T E A E L Q D M I N E V D A D G D G T I D F P E F L T M M A R K M W G T D S E E E I R E A F R V F D K D G N G Y I G A A E L R H V M A N L G E R L T D E E V D E M I R V A D I N G D G Q V S Y E E F V Q M M T A K
    • Please see this link to our available calmodulin antibodies. This sequences shares 94% similarity with human calmodulin and does not share 100% similarity with any known calmodulin sequence. Any of our calmodulin antibodies will be predicted to react with this sequence. Any of our polyclonal antibodies will be a good choice and chances are most of the monoclonal antibodies will cross-react as well although, unfortunately, there is no way to predict this with the monoclonals. NBP1-61548 would be my best recommendation for your assay and sequence.

Secondary Antibodies

 

Isotype Controls

Additional Calmodulin Products

Research Areas for Calmodulin Antibody (NBP3-16500)

Find related products by research area.

Blogs on Calmodulin

There are no specific blogs for Calmodulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calmodulin Antibody (10W3Y7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CALM1