Calmodulin Antibody (10W3Y7) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1). LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CALM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:1000 - 1:6000
|
| Theoretical MW |
16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Calmodulin Antibody (10W3Y7)
Background
Calmoduin (CaM) is a calcium modulator protein and a transducer of calcium signals (1-2). Upon calcium binding, calmodulin undergoes conformational changes and binds and modulates a diverse array of proteins. Calcium-bound CaM (Ca2+-CaM) can assume a variety of shapes depending on the target (3). Ca2+-CaM binds many kinases, phosphatases, signaling proteins, and structural proteins affecting a wide variety of processes including neurotransmitter release, muscle contraction, metabolism, apoptosis, inflammation, membrane protein organization, and cytoskeleton movement (2, 4-5).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Publications for Calmodulin Antibody (NBP3-16500) (0)
There are no publications for Calmodulin Antibody (NBP3-16500).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Calmodulin Antibody (NBP3-16500) (0)
There are no reviews for Calmodulin Antibody (NBP3-16500).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Calmodulin Antibody (NBP3-16500). (Showing 1 - 1 of 1 FAQ).
-
I am looking for an antibody that can bind an engineered calmodulin domain of a fluorescent biosensor. Can you provide me the amino acid sequence that your calmodulin antibodies were raised against so that I can compare them to the sequence I am working with? Can you please provide your sequence identity for this fragment: D Q L T E E Q I A E F K E A F S L F D K D G D G T I T T K E L G T V M R S L G Q N P T E A E L Q D M I N E V D A D G D G T I D F P E F L T M M A R K M W G T D S E E E I R E A F R V F D K D G N G Y I G A A E L R H V M A N L G E R L T D E E V D E M I R V A D I N G D G Q V S Y E E F V Q M M T A K
- Please see this link to our available calmodulin antibodies. This sequences shares 94% similarity with human calmodulin and does not share 100% similarity with any known calmodulin sequence. Any of our calmodulin antibodies will be predicted to react with this sequence. Any of our polyclonal antibodies will be a good choice and chances are most of the monoclonal antibodies will cross-react as well although, unfortunately, there is no way to predict this with the monoclonals. NBP1-61548 would be my best recommendation for your assay and sequence.
Secondary Antibodies
| |
Isotype Controls
|
Additional Calmodulin Products
Research Areas for Calmodulin Antibody (NBP3-16500)
Find related products by research area.
|
Blogs on Calmodulin