Calmodulin 3 Antibody


Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human HepG2, Antibody Dilution: 1.0 ug/ml CALM3 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human MCF7, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Calmodulin 3 Antibody Summary

The immunogen for this antibody is Calmodulin 3 - N-terminal region. Peptide sequence LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Calmodulin 3 Lysate (NBP2-66051)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Calmodulin 3 Antibody

  • CALM
  • CALM1
  • CALM2
  • CALML2
  • calmodulin 3 (phosphorylase kinase, delta)
  • calmodulin
  • CAM
  • CAM1
  • CAM2
  • CAM3
  • CAMB
  • CAMC
  • PHKD
  • PHKD3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Calmodulin 3 Antibody (NBP1-98474) (0)

There are no publications for Calmodulin 3 Antibody (NBP1-98474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calmodulin 3 Antibody (NBP1-98474) (0)

There are no reviews for Calmodulin 3 Antibody (NBP1-98474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calmodulin 3 Antibody (NBP1-98474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Calmodulin 3 Antibody (NBP1-98474)

Discover related pathways, diseases and genes to Calmodulin 3 Antibody (NBP1-98474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calmodulin 3 Antibody (NBP1-98474)

Discover more about diseases related to Calmodulin 3 Antibody (NBP1-98474).

Pathways for Calmodulin 3 Antibody (NBP1-98474)

View related products by pathway.

PTMs for Calmodulin 3 Antibody (NBP1-98474)

Learn more about PTMs related to Calmodulin 3 Antibody (NBP1-98474).

Research Areas for Calmodulin 3 Antibody (NBP1-98474)

Find related products by research area.

Blogs on Calmodulin 3

There are no specific blogs for Calmodulin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Calmodulin 3 Antibody and receive a gift card or discount.


Gene Symbol CALM3