CADPS Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: CADPS Antibody [NBP3-04378] - Paraffin-embedded human breast cancer using CADPS antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: CADPS Antibody [NBP3-04378] - Paraffin-embedded human stomach using CADPS antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu
• Applications: ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CADPS Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit CADPS Antibody - Azide and BSA Free (NBP3-04378) is a polyclonal antibody validated for use in IHC and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1020-1100 of human CADPS (NP_899630.1). MASDMIESCVKRTRIAFEVKLQKTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMIT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CADPS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
• Theoretical MW: 153 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for CADPS Antibody - Azide and BSA Free

• Ca++-dependent secretion activator
• CADPS1
• Calcium-dependent activator protein for secretion 1
• calcium-dependent secretion activator 1
• CAPS-1
• CAPS1Ca2+-dependent secretion activator
• CAPSCa2+-dependent activator protein for secretion
• KIAA1121Ca2+-regulated cytoskeletal protein

Background

CADPS encodes a novel neural/endocrine-specific cytosolic and peripheral membrane protein required for the Ca2+-regulated exocytosis of secretory vesicles. The protein acts at a stage in exocytosis that follows ATP-dependent priming, which involves the essential synthesis of phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: CADPS