Cadherin-12 Antibody

Images

 
Western Blot: Cadherin-12 Antibody [NBP1-59225] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: 721_B cell lysate CDH12 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: Cadherin-12 Antibody [NBP1-59225] - WB assay of 721 B cell lysate with Cadherin-12 Antibody

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cadherin-12 Antibody Summary

Immunogen
Synthetic peptides corresponding to CDH12(cadherin 12, type 2 (N-cadherin 2)) The peptide sequence was selected from the middle region of CDH12. Peptide sequence DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDH12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CDH12 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cadherin-12 Antibody

  • Br-Cadherin
  • cadherin 12, type 2 (N-cadherin 2)
  • Cadherin12
  • Cadherin-12
  • CDH12
  • CDHB
  • FLJ34857
  • N-Cadherin 2
  • Neural type cadherin 2
  • neural type, 2
  • neuronal cadherin 2

Background

CDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.This gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin appears to be expressed specifically in the brain and its temporal pattern of expression would be consistent with a role during a critical period of neuronal development, perhaps specifically during synaptogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13780
Species: Hu
Applications: IHC, IHC-P
NBP1-88300
Species: Hu
Applications: IHC, IHC-P
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
H00023316-M03
Species: Hu
Applications: WB, ELISA
AF2030
Species: Hu
Applications: WB, IHC
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
MAB7926
Species: Mu
Applications: WB, IHC
H00028513-B01P
Species: Hu
Applications: WB, ELISA
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB

Publications for Cadherin-12 Antibody (NBP1-59225) (0)

There are no publications for Cadherin-12 Antibody (NBP1-59225).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-12 Antibody (NBP1-59225) (0)

There are no reviews for Cadherin-12 Antibody (NBP1-59225). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-12 Antibody (NBP1-59225) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-12 Products

Bioinformatics Tool for Cadherin-12 Antibody (NBP1-59225)

Discover related pathways, diseases and genes to Cadherin-12 Antibody (NBP1-59225). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-12 Antibody (NBP1-59225)

Discover more about diseases related to Cadherin-12 Antibody (NBP1-59225).
 

Pathways for Cadherin-12 Antibody (NBP1-59225)

View related products by pathway.

Blogs on Cadherin-12

There are no specific blogs for Cadherin-12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH12
Entrez
Uniprot