![Immunohistochemistry-Paraffin: CDH22 Antibody [NBP1-88300] - Staining of human kidney shows strong cytoplasmic positivity in a subset of cells in tubules.](http://images.novusbio.com/fullsize/CDH22-Antibody-Immunohistochemistry-Paraffin-NBP1-88300-img0002.jpg "Immunohistochemistry-Paraffin: CDH22 Antibody [NBP1-88300] - Staining of human kidney shows strong cytoplasmic positivity in a subset of cells in tubules.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Cadherin-22 Antibody - BSA Free (NBP1-88300) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFESQPVHTVILEALNKFVDPRFADLGTFRDQAIVRVAVTDVDEP |
| Predicted Species | Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDH22 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDH22 |
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Cadherin-12 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Cadherin-12 [Unconjugated]")
![Immunocytochemistry Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Immunocytochemistry_11033.jpg)
![Immunohistochemistry Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Immunohistochemistry_22974.jpg)
![Simple Western Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Simple_Western_20223.jpg)
![Flow Cytometry Cadherin-6/KCAD Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin-6_AF2715_Flow_Cytometry_8181.jpg)
![Immunocytochemistry Cadherin-6/KCAD Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin-6_AF2715_Immunocytochemistry_9776.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")