CABYR Antibody - Azide and BSA Free Summary
| Immunogen |
CABYR (NP_619585.1, 1 a.a. - 379 a.a.) full-length human protein. MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CABYR |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CABYR Antibody - Azide and BSA Free
Background
To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Transcript variants of this gene encode multiple protein isoforms. An additional transcript and isoform has not been fully characterized. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Publications for CABYR Antibody (H00026256-B01P) (0)
There are no publications for CABYR Antibody (H00026256-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CABYR Antibody (H00026256-B01P) (0)
There are no reviews for CABYR Antibody (H00026256-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CABYR Antibody (H00026256-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CABYR Products
Research Areas for CABYR Antibody (H00026256-B01P)
Find related products by research area.
|
Blogs on CABYR