CAB39 Antibody

Images

 
Western Blot: CAB39 Antibody [NBP1-55393] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAB39 Antibody Summary

Immunogen
Synthetic peptides corresponding to CAB39(calcium binding protein 39) The peptide sequence was selected from the middle region of CAB39. Peptide sequence KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAB39
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CAB39 and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CAB39 Antibody

  • calcium binding protein 39
  • calcium-binding protein 39
  • FLJ22682
  • MO25CGI-66
  • Protein Mo25

Background

Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24700
Species: Hu, Mu
Applications: WB
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2854
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00130497-M10
Species: Hu
Applications: ELISA
NBP1-44270
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-52148
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA, IF
NBP1-84907
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24680
Species: Hu, Bv, Ca, Eq, Pm
Applications: WB, IHC, IHC-P
NBP2-31993
Species: Hu
Applications: WB, IHC, IHC-P
H00051765-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84621
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CAB39 Antibody (NBP1-55393) (0)

There are no publications for CAB39 Antibody (NBP1-55393).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAB39 Antibody (NBP1-55393) (0)

There are no reviews for CAB39 Antibody (NBP1-55393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAB39 Antibody (NBP1-55393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CAB39 Products

Bioinformatics Tool for CAB39 Antibody (NBP1-55393)

Discover related pathways, diseases and genes to CAB39 Antibody (NBP1-55393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAB39 Antibody (NBP1-55393)

Discover more about diseases related to CAB39 Antibody (NBP1-55393).
 

Pathways for CAB39 Antibody (NBP1-55393)

View related products by pathway.

PTMs for CAB39 Antibody (NBP1-55393)

Learn more about PTMs related to CAB39 Antibody (NBP1-55393).
 

Research Areas for CAB39 Antibody (NBP1-55393)

Find related products by research area.

Blogs on CAB39

There are no specific blogs for CAB39, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAB39 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAB39
Uniprot