ALS2CR2 Antibody

Images

 
Western Blot: ALS2CR2 Antibody [NBP1-90183] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ALS2CR2 Antibody [NBP1-90183] - Staining of human cell line U-2 OS shows localization to cytosol & aggresome.
Immunohistochemistry-Paraffin: ALS2CR2 Antibody [NBP1-90183] - Staining of human adrenal gland shows cytoplasmic positivity in glandular cells.
Western Blot: ALS2CR2 Antibody [NBP1-90183] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALS2CR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STRADB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALS2CR2 Protein (NBP1-90183PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALS2CR2 Antibody

  • ALS2CR2candidate 2
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein
  • CALS-21MGC102916
  • ILP-interacting protein
  • ILPIPSTRAD beta
  • Pseudokinase ALS2CR2
  • STE20-related kinase adaptor beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15369
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-01317
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24700
Species: Hu
Applications: WB
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56123
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP

Publications for ALS2CR2 Antibody (NBP1-90183) (0)

There are no publications for ALS2CR2 Antibody (NBP1-90183).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALS2CR2 Antibody (NBP1-90183) (0)

There are no reviews for ALS2CR2 Antibody (NBP1-90183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALS2CR2 Antibody (NBP1-90183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALS2CR2 Products

Bioinformatics Tool for ALS2CR2 Antibody (NBP1-90183)

Discover related pathways, diseases and genes to ALS2CR2 Antibody (NBP1-90183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALS2CR2 Antibody (NBP1-90183)

Discover more about diseases related to ALS2CR2 Antibody (NBP1-90183).

Research Areas for ALS2CR2 Antibody (NBP1-90183)

Find related products by research area.

Blogs on ALS2CR2

There are no specific blogs for ALS2CR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALS2CR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STRADB
Entrez
Uniprot