C9orf103 Antibody

Images

 
Immunohistochemistry-Paraffin: C9orf103 Antibody [NBP1-88751] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C9orf103 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRDVASGQRVVLACSALKKTYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IDNK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C9orf103 Protein (NBP1-88751PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C9orf103 Antibody

  • bA522I20.2
  • C9orf103
  • chromosome 9 open reading frame 103
  • EC 2.7.1.12
  • glucokinase-like protein
  • Gluconate kinase
  • gluconokinase-like protein
  • idnK, gluconokinase homolog (E. coli)
  • probable gluconokinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-57033
Species: Hu
Applications: WB
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
AF1936
Species: Hu
Applications: WB, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-84418
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88751
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for C9orf103 Antibody (NBP1-88751) (0)

There are no publications for C9orf103 Antibody (NBP1-88751).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C9orf103 Antibody (NBP1-88751) (0)

There are no reviews for C9orf103 Antibody (NBP1-88751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C9orf103 Antibody (NBP1-88751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C9orf103 Products

Bioinformatics Tool for C9orf103 Antibody (NBP1-88751)

Discover related pathways, diseases and genes to C9orf103 Antibody (NBP1-88751). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for C9orf103 Antibody (NBP1-88751)

View related products by pathway.

PTMs for C9orf103 Antibody (NBP1-88751)

Learn more about PTMs related to C9orf103 Antibody (NBP1-88751).
 

Research Areas for C9orf103 Antibody (NBP1-88751)

Find related products by research area.

Blogs on C9orf103

There are no specific blogs for C9orf103, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C9orf103 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IDNK