C8G Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C8G. Peptide sequence: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
C8G |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for C8G Antibody - BSA Free
Background
C8G is one of the three polypeptides that constitute C8, a component of the complement system. C8 participates in the formation of Membrane Attack Complex (MAC). Patients with deficiency in C8 are vulnerable to certain bacteria infection. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, IHC, IHC-Fr, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Publications for C8G Antibody (NBP2-82951) (0)
There are no publications for C8G Antibody (NBP2-82951).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for C8G Antibody (NBP2-82951) (0)
There are no reviews for C8G Antibody (NBP2-82951).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for C8G Antibody (NBP2-82951) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional C8G Products
Research Areas for C8G Antibody (NBP2-82951)
Find related products by research area.
|
Blogs on C8G