![Western Blot: C2orf88 Antibody [NBP2-14407] - Analysis in control (vector only transfected HEK293T lysate) and C2orf88 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/C2orf88-Antibody-Western-Blot-NBP2-14407-img0004.jpg "Western Blot: C2orf88 Antibody [NBP2-14407] - Analysis in control (vector only transfected HEK293T lysate) and C2orf88 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit C2orf88 Antibody - BSA Free (NBP2-14407) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDILCDA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C2ORF88 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RII_AF241NA_Western_Blot_21284.jpg)
![Neutralization TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RII_AF-241-NA_Block_Neutralize_8662.jpg)
![Immunohistochemistry TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RII_AF-241-NA_Immunohistochemistry_9941.jpg)
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C2ORF88 |
![Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human small intestine strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/C2orf88-Antibody-Immunohistochemistry-Paraffin-NBP2-14407-img0008.jpg "Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human small intestine strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/C2orf88-Antibody-Immunohistochemistry-Paraffin-NBP2-14407-img0002.jpg "Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human cerebellum shows no positivity in Purkinje cells, as expected.](http://images.novusbio.com/fullsize/C2orf88-Antibody-Immunohistochemistry-Paraffin-NBP2-14407-img0005.jpg "Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human cerebellum shows no positivity in Purkinje cells, as expected.")
![Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human endometrium shows strong membranous/cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/C2orf88-Antibody-Immunohistochemistry-Paraffin-NBP2-14407-img0006.jpg "Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human endometrium shows strong membranous/cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human pancreas shows strong membranous/cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/C2orf88-Antibody-Immunohistochemistry-Paraffin-NBP2-14407-img0007.jpg "Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human pancreas shows strong membranous/cytoplasmic positivity in exocrine glandular cells.")
![SDS-PAGE GDF-8/Myostatin [Unconjugated]](https://images.novusbio.com/images2/GDF-8_788-G8_CF_114.jpg)
![Bioactivity GDF-8/Myostatin [Unconjugated]](https://images.novusbio.com/images2/GDF-8_788-G8_CF_116.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![Western Blot STAT4 [p Tyr693] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT4_AF4319_Western_Blot_5439.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")