C2orf88 Antibody

Images

 
Western Blot: C2orf88 Antibody [NBP2-14407] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: C2orf88 Antibody [NBP2-14407] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C2orf88 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKE PPGTNTVILEYAHRLSQDILCDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C2ORF88
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C2orf88 Protein (NBP2-14407PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40%
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C2orf88 Antibody

  • chromosome 2 open reading frame 88
  • hypothetical protein LOC84281
  • MGC13057

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP2-02673
Species: Hu, Ca
Applications: WB, Flow, IHC, IHC-P
NBP2-55525
Species: Hu
Applications: ICC/IF
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3025
Species: Hu
Applications: WB, ICC
NBP1-93912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21502
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56777
Species: Hu
Applications: ICC/IF
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-76577
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82296
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for C2orf88 Antibody (NBP2-14407) (0)

There are no publications for C2orf88 Antibody (NBP2-14407).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C2orf88 Antibody (NBP2-14407) (0)

There are no reviews for C2orf88 Antibody (NBP2-14407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C2orf88 Antibody (NBP2-14407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C2orf88 Products

Bioinformatics Tool for C2orf88 Antibody (NBP2-14407)

Discover related pathways, diseases and genes to C2orf88 Antibody (NBP2-14407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C2orf88 Antibody (NBP2-14407)

Discover more about diseases related to C2orf88 Antibody (NBP2-14407).
 

Pathways for C2orf88 Antibody (NBP2-14407)

View related products by pathway.

Blogs on C2orf88

There are no specific blogs for C2orf88, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C2orf88 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C2ORF88