ANKAR Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKAR Antibody [NBP1-93912] - Immunofluorescent staining of human cell line A-431 shows localization to microtubule organizing center.
Immunohistochemistry-Paraffin: ANKAR Antibody [NBP1-93912] - Staining of human pancreas shows strong nuclear and cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKAR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QLPPAYYDTRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRAIMDIDPDGKPQTNKDIFSEFSSAGLTDITKDPDFNEIYDEDVNEDP
Specificity
Specificity of human ANKAR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKAR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKAR Antibody

  • ankyrin and armadillo repeat containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-8146
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP2-02673
Species: Hu, Ca
Applications: WB, Flow, IHC, IHC-P
NBP2-55525
Species: Hu
Applications: ICC/IF
NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21502
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-68870
Species: Hu
Applications: ICC/IF
NB600-594
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-76577
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67868
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-84553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14407
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82296
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-83634
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ANKAR Antibody (NBP1-93912) (0)

There are no publications for ANKAR Antibody (NBP1-93912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKAR Antibody (NBP1-93912) (0)

There are no reviews for ANKAR Antibody (NBP1-93912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKAR Antibody (NBP1-93912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ANKAR Products

Array NBP1-93912

Bioinformatics Tool for ANKAR Antibody (NBP1-93912)

Discover related pathways, diseases and genes to ANKAR Antibody (NBP1-93912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKAR Antibody (NBP1-93912)

Discover more about diseases related to ANKAR Antibody (NBP1-93912).
 

Pathways for ANKAR Antibody (NBP1-93912)

View related products by pathway.

Blogs on ANKAR

There are no specific blogs for ANKAR, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKAR
Entrez
Uniprot
COVID-19 update