DIRC1 Antibody


Immunocytochemistry/ Immunofluorescence: DIRC1 Antibody [NBP2-68870] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

DIRC1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for DIRC1 Antibody

  • Disrupted In Renal Cancer Protein
  • Disrupted In Renal Carcinoma 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
Species: Hu, Ca
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for DIRC1 Antibody (NBP2-68870) (0)

There are no publications for DIRC1 Antibody (NBP2-68870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIRC1 Antibody (NBP2-68870) (0)

There are no reviews for DIRC1 Antibody (NBP2-68870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DIRC1 Antibody (NBP2-68870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DIRC1 Products

Array NBP2-68870

Bioinformatics Tool for DIRC1 Antibody (NBP2-68870)

Discover related pathways, diseases and genes to DIRC1 Antibody (NBP2-68870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIRC1 Antibody (NBP2-68870)

Discover more about diseases related to DIRC1 Antibody (NBP2-68870).

Pathways for DIRC1 Antibody (NBP2-68870)

View related products by pathway.

Blogs on DIRC1

There are no specific blogs for DIRC1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DIRC1 Antibody and receive a gift card or discount.


Gene Symbol DIRC1
Novus 100% Guarantee