![Immunohistochemistry-Paraffin: C21orf62 Antibody [NBP1-88947] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/C21orf62-Antibody-Immunohistochemistry-Paraffin-NBP1-88947-img0005.jpg "Immunohistochemistry-Paraffin: C21orf62 Antibody [NBP1-88947] - Staining of human kidney shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit C21orf62 Antibody - BSA Free (NBP1-88947) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWLHKGWQPCMYISFLD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C21ORF62 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
![Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Flow_Cytometry_16025.jpg)
![Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Immunohistochemistry_17363.jpg)
![Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Dual_RNAscope_ISHIHC_23827.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C21ORF62 |
![Immunohistochemistry-Paraffin: C21orf62 Antibody [NBP1-88947] - Staining of human duodenum shows low expression as expected.](http://images.novusbio.com/fullsize/C21orf62-Antibody-Immunohistochemistry-Paraffin-NBP1-88947-img0004.jpg "Immunohistochemistry-Paraffin: C21orf62 Antibody [NBP1-88947] - Staining of human duodenum shows low expression as expected.")
![Immunohistochemistry-Paraffin: C21orf62 Antibody [NBP1-88947] - Staining in human kidney and duodenum tissues using anti-C21orf62 antibody. Corresponding C21orf62 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/C21orf62-Antibody-Immunohistochemistry-Paraffin-NBP1-88947-img0006.jpg "Immunohistochemistry-Paraffin: C21orf62 Antibody [NBP1-88947] - Staining in human kidney and duodenum tissues using anti-C21orf62 antibody. Corresponding C21orf62 RNA-seq data are presented for the same tissues.")
![Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Block_Neutralize_875.jpg)
![Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Western_Blot_5303.jpg)
![Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Immunohistochemistry_17355.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")