Recombinant Human C1qTNF3/CORS26/CTRP3 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related C1qTNF3/CORS26/CTRP3 Peptides and Proteins

Order Details


    • Catalog Number
      H00114899-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human C1qTNF3/CORS26/CTRP3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 246 of Human C1QTNF3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
C1QTNF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
53.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C1qTNF3/CORS26/CTRP3 Protein

  • C1ATNF3
  • C1q and tumor necrosis factor related protein 3
  • C1qTNF3
  • Cartducin
  • cartonectin
  • collagenous repeat-containing sequence of 26-kDa
  • complement C1q tumor necrosis factor-related protein 3
  • complement-c1q tumor necrosis factor-related protein 3
  • Corcs
  • Cors
  • CORS26
  • Cors-26
  • CTRP3
  • CTRP32310005P21Rik
  • FLJ37576
  • Secretory protein CORS26

Background

Adipose tissue of an organism plays a major role in regulating physiologic and pathologic processes such as metabolism and immunity by producing and secreting a variety of bioactive molecules termed adipokines. One highly conserved family of adipokines is adiponectin/ACRP30 and its structural and functional paralogs, the C1q/tumor necrosis factor-alpha-related proteins (CTRPs) 1-7. Unlike adiponectin, which is expressed exclusively by differentiated adipocytes, the CTRPs are expressed in a wide variety of tissues. An analysis of the crystal structure of adiponectin revealed a structural and evolutionary link between TNF and C1q-containing proteins, suggesting that these proteins arose from a common ancestral innate immunity gene. Multiple isoforms of human CTRP3 have been reported. It has been suggested that CTRP3 may play a role in skeletal development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DRP300
Species: Hu
Applications: ELISA
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
DRSN00
Species: Hu
Applications: ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
DLP00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4254
Species: Hu
Applications: ICC, IHC, WB
NBP1-32252
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC,  IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00114899-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for C1qTNF3/CORS26/CTRP3 Recombinant Protein (H00114899-P01) (0)

There are no publications for C1qTNF3/CORS26/CTRP3 Recombinant Protein (H00114899-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1qTNF3/CORS26/CTRP3 Recombinant Protein (H00114899-P01) (0)

There are no reviews for C1qTNF3/CORS26/CTRP3 Recombinant Protein (H00114899-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1qTNF3/CORS26/CTRP3 Recombinant Protein (H00114899-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C1qTNF3/CORS26/CTRP3 Products

Research Areas for C1qTNF3/CORS26/CTRP3 Recombinant Protein (H00114899-P01)

Find related products by research area.

Blogs on C1qTNF3/CORS26/CTRP3

There are no specific blogs for C1qTNF3/CORS26/CTRP3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C1qTNF3/CORS26/CTRP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QTNF3