C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen

Images

 
There are currently no images for C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen (NBP2-57665PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C1qTNF3/CORS26/CTRP3.

Source: E. coli

Amino Acid Sequence: CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
C1QTNF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57665.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen

  • C1ATNF3
  • C1q and tumor necrosis factor related protein 3
  • C1qTNF3
  • Cartducin
  • cartonectin
  • collagenous repeat-containing sequence of 26-kDa
  • complement C1q tumor necrosis factor-related protein 3
  • complement-c1q tumor necrosis factor-related protein 3
  • Corcs
  • Cors
  • CORS26
  • Cors-26
  • CTRP3
  • CTRP32310005P21Rik
  • FLJ37576
  • Secretory protein CORS26

Background

Adipose tissue of an organism plays a major role in regulating physiologic and pathologic processes such as metabolism and immunity by producing and secreting a variety of bioactive molecules termed adipokines. One highly conserved family of adipokines is adiponectin/ACRP30 and its structural and functional paralogs, the C1q/tumor necrosis factor-alpha-related proteins (CTRPs) 1-7. Unlike adiponectin, which is expressed exclusively by differentiated adipocytes, the CTRPs are expressed in a wide variety of tissues. An analysis of the crystal structure of adiponectin revealed a structural and evolutionary link between TNF and C1q-containing proteins, suggesting that these proteins arose from a common ancestral innate immunity gene. Multiple isoforms of human CTRP3 have been reported. It has been suggested that CTRP3 may play a role in skeletal development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DRP300
Species: Hu
Applications: ELISA
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
DRSN00
Species: Hu
Applications: ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
DLP00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4254
Species: Hu
Applications: ICC, IHC, WB
NBP1-32252
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC,  IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-57665PEP
Species: Hu
Applications: AC

Publications for C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen (NBP2-57665PEP) (0)

There are no publications for C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen (NBP2-57665PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen (NBP2-57665PEP) (0)

There are no reviews for C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen (NBP2-57665PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen (NBP2-57665PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C1qTNF3/CORS26/CTRP3 Products

Research Areas for C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen (NBP2-57665PEP)

Find related products by research area.

Blogs on C1qTNF3/CORS26/CTRP3

There are no specific blogs for C1qTNF3/CORS26/CTRP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QTNF3