C19orf48 Antibody

Images

 
Western Blot: C19orf48 Antibody [NBP1-81210] - Analysis in control (vector only transfected HEK293T lysate) and C19orf48 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: C19orf48 Antibody [NBP1-81210] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: C19orf48 Antibody [NBP1-81210] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: C19orf48 Antibody [NBP1-81210] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: C19orf48 Antibody [NBP1-81210] - Staining of human lymph node shows strong cytoplasmic positivity in a small subset of lymphoid cells.
Immunohistochemistry-Paraffin: C19orf48 Antibody [NBP1-81210] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C19orf48 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C19ORF48
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C19orf48 Protein (NBP1-81210PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C19orf48 Antibody

  • chromosome 19 open reading frame 48
  • MGC13170
  • Multidrug resistance-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C19orf48 Antibody (NBP1-81210) (0)

There are no publications for C19orf48 Antibody (NBP1-81210).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C19orf48 Antibody (NBP1-81210) (0)

There are no reviews for C19orf48 Antibody (NBP1-81210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C19orf48 Antibody (NBP1-81210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C19orf48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C19ORF48
Entrez