C-Reactive Protein/CRP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRP. Source: E. coli
Amino Acid Sequence: MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CRP |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87184. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for C-Reactive Protein/CRP Recombinant Protein Antigen
Background
C Reactive Protein is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is a pentraxin (cyclic pentameric protein) compound of five identical nonglycosylated subunits of 206 amino acids each (m.w. 24 kDa), that are bound noncovalently to form the physiologic CRP molecule (m.w. 117.5 kDa). C Reactive Protein mediates activities associated with preimmune nonspecific host resistance. It is opsonic, an initiator of the classical complement cascade and an activator of monocytes/macrophages. CRP also binds to several nuclear components including chromatin, histones and snRNP, suggesting that it may play a role as a scavenger during cell necrosis. Studies have revealed that among other markers of inflammation, CRP shows the strongest association with cardiovascular events. Many clinical studies demonstrated that coronary mortality among patients with unstable angina and elevated CRP is significantly higher comparing with the patients without elevated CRP. Measurements of C reactive protein (hsCRP) in the patients with ischemic heart disease provide a novel method for detecting individuals at high risk of plaque rupture.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Publications for C-Reactive Protein/CRP Protein (NBP1-87184PEP) (0)
There are no publications for C-Reactive Protein/CRP Protein (NBP1-87184PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for C-Reactive Protein/CRP Protein (NBP1-87184PEP) (0)
There are no reviews for C-Reactive Protein/CRP Protein (NBP1-87184PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for C-Reactive Protein/CRP Protein (NBP1-87184PEP) (0)
Additional C-Reactive Protein/CRP Products
Research Areas for C-Reactive Protein/CRP Protein (NBP1-87184PEP)
Find related products by research area.
|
Blogs on C-Reactive Protein/CRP