C-Reactive Protein/CRP Recombinant Protein Antigen

Images

 
There are currently no images for C-Reactive Protein/CRP Protein (NBP1-87183PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

C-Reactive Protein/CRP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRP.

Source: E. coli

Amino Acid Sequence: VRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87183.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for C-Reactive Protein/CRP Recombinant Protein Antigen

  • C-Reactive Protein
  • C-reactive protein, pentraxin-related
  • CRP
  • MGC88244
  • pentraxin 1
  • PTX1MGC149895

Background

C Reactive Protein is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is a pentraxin (cyclic pentameric protein) compound of five identical nonglycosylated subunits of 206 amino acids each (m.w. 24 kDa), that are bound noncovalently to form the physiologic CRP molecule (m.w. 117.5 kDa). C Reactive Protein mediates activities associated with preimmune nonspecific host resistance. It is opsonic, an initiator of the classical complement cascade and an activator of monocytes/macrophages. CRP also binds to several nuclear components including chromatin, histones and snRNP, suggesting that it may play a role as a scavenger during cell necrosis. Studies have revealed that among other markers of inflammation, CRP shows the strongest association with cardiovascular events. Many clinical studies demonstrated that coronary mortality among patients with unstable angina and elevated CRP is significantly higher comparing with the patients without elevated CRP. Measurements of C reactive protein (hsCRP) in the patients with ischemic heart disease provide a novel method for detecting individuals at high risk of plaque rupture.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
DRP300
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
DLP00
Species: Hu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
DHAPG0
Species: Hu
Applications: ELISA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
2914-HT
Species: Hu
Applications: BA
201-LB
Species: Hu
Applications: BA
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DSE100
Species: Hu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
MPTX20
Species: Mu
Applications: ELISA

Publications for C-Reactive Protein/CRP Protein (NBP1-87183PEP) (0)

There are no publications for C-Reactive Protein/CRP Protein (NBP1-87183PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C-Reactive Protein/CRP Protein (NBP1-87183PEP) (0)

There are no reviews for C-Reactive Protein/CRP Protein (NBP1-87183PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for C-Reactive Protein/CRP Protein (NBP1-87183PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C-Reactive Protein/CRP Products

Research Areas for C-Reactive Protein/CRP Protein (NBP1-87183PEP)

Find related products by research area.

Blogs on C-Reactive Protein/CRP

There are no specific blogs for C-Reactive Protein/CRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our C-Reactive Protein/CRP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CRP