Butyrylcholinesterase/BCHE Antibody

Images

 
Immunohistochemistry: Butyrylcholinesterase/BCHE Antibody [NBP1-85633] - Human skeletal muscle showing moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Butyrylcholinesterase/BCHE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCHE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
Butyrylcholinesterase/BCHE Protein (NBP1-85633PEP)
Publications
Read Publication using NBP1-85633.

Alternate Names for Butyrylcholinesterase/BCHE Antibody

  • Acylcholine acylhydrolase
  • BCHE
  • Butyrylcholine esterase
  • butyrylcholinesterase
  • Butyrylcholinesterase/BCHE
  • CHE1
  • CHE1cholinesterase
  • Choline esterase II
  • cholinesterase 1
  • E1
  • EC 3.1.1.8
  • Pseudocholinesterase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: ICFlow
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-WhMt
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7445
Species: Hu
Applications: WB
NBP1-85633
Species: Hu
Applications: IHC, IHC-P

Publications for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)(1)

Reviews for Butyrylcholinesterase/BCHE Antibody (NBP1-85633) (0)

There are no reviews for Butyrylcholinesterase/BCHE Antibody (NBP1-85633). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Butyrylcholinesterase/BCHE Antibody (NBP1-85633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Butyrylcholinesterase/BCHE Antibody Products

Related Products by Gene

Bioinformatics Tool for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)

Discover related pathways, diseases and genes to Butyrylcholinesterase/BCHE Antibody (NBP1-85633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)

Discover more about diseases related to Butyrylcholinesterase/BCHE Antibody (NBP1-85633).
 

Pathways for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)

View related products by pathway.

PTMs for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)

Learn more about PTMs related to Butyrylcholinesterase/BCHE Antibody (NBP1-85633).

Blogs on Butyrylcholinesterase/BCHE

There are no specific blogs for Butyrylcholinesterase/BCHE, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol BCHE
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-85633 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought