Butyrylcholinesterase/BCHE Antibody

Images

 
Immunohistochemistry-Paraffin: Butyrylcholinesterase/BCHE Antibody [NBP1-85633] - Staining of human liver shows cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Butyrylcholinesterase/BCHE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCHE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
Butyrylcholinesterase/BCHE Protein (NBP1-85633PEP)
Publications
Read Publication using NBP1-85633.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Butyrylcholinesterase/BCHE Antibody

  • Acylcholine acylhydrolase
  • BCHE
  • Butyrylcholine esterase
  • Butyrylcholinesterase
  • CHE1
  • CHE1cholinesterase
  • Choline esterase II
  • cholinesterase 1
  • E1
  • EC 3.1.1.8
  • Pseudocholinesterase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-WhMt
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85633
Species: Hu
Applications: IHC, IHC-P

Publications for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)(1)

Reviews for Butyrylcholinesterase/BCHE Antibody (NBP1-85633) (0)

There are no reviews for Butyrylcholinesterase/BCHE Antibody (NBP1-85633). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Butyrylcholinesterase/BCHE Antibody (NBP1-85633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Butyrylcholinesterase/BCHE Antibody Products

Related Products by Gene

Bioinformatics Tool for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)

Discover related pathways, diseases and genes to Butyrylcholinesterase/BCHE Antibody (NBP1-85633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)

Discover more about diseases related to Butyrylcholinesterase/BCHE Antibody (NBP1-85633).
 

Pathways for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)

View related products by pathway.

PTMs for Butyrylcholinesterase/BCHE Antibody (NBP1-85633)

Learn more about PTMs related to Butyrylcholinesterase/BCHE Antibody (NBP1-85633).

Blogs on Butyrylcholinesterase/BCHE

There are no specific blogs for Butyrylcholinesterase/BCHE, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Butyrylcholinesterase/BCHE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCHE
Entrez

Customers Who Bought This Also Bought