BUD13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BUD13 Antibody [NBP2-38407] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: BUD13 Antibody [NBP2-38407] - Staining of human cerebral cortex.
Immunohistochemistry: BUD13 Antibody [NBP2-38407] - Staining of human testis shows distinct nuclear positivity in cells in seminiferous ducts.
Independent Antibodies: Immunohistochemistry-Paraffin: BUD13 Antibody [NBP2-38407] - Staining of human cerebral cortex, colon, kidney and testis using Anti-BUD13 antibody NBP2-38407 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: BUD13 Antibody [NBP2-38407] - Staining of human testis.
Immunohistochemistry-Paraffin: BUD13 Antibody [NBP2-38407] - Staining of human colon.
Immunohistochemistry-Paraffin: BUD13 Antibody [NBP2-38407] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

BUD13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKAT
Specificity
Specificity of human BUD13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BUD13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BUD13 Antibody

  • BUD13 homolog (S. cerevisiae)
  • fSAP71
  • MGC13125

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2595
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB400-104
Species: Hu, Mu, Rt, Po, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, KO
NBP2-52979
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38172
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86461
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-80524
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004143-M01
Species: Hu, Ce
Applications: WB, ELISA, IP
H00005355-P01
Species: Hu
NBP2-13923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32127
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for BUD13 Antibody (NBP2-38407) (0)

There are no publications for BUD13 Antibody (NBP2-38407).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BUD13 Antibody (NBP2-38407) (0)

There are no reviews for BUD13 Antibody (NBP2-38407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BUD13 Antibody (NBP2-38407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BUD13 Products

Array NBP2-38407

Bioinformatics Tool for BUD13 Antibody (NBP2-38407)

Discover related pathways, diseases and genes to BUD13 Antibody (NBP2-38407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BUD13 Antibody (NBP2-38407)

Discover more about diseases related to BUD13 Antibody (NBP2-38407).
 

Pathways for BUD13 Antibody (NBP2-38407)

View related products by pathway.

Blogs on BUD13

There are no specific blogs for BUD13, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BUD13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BUD13
Uniprot
Novus 100% Guarantee