CYP4F2 Antibody


Western Blot: CYP4F2 Antibody [NBP1-86461] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunohistochemistry: CYP4F2 Antibody [NBP1-86461] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CYP4F2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD
Specificity of human CYP4F2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYP4F2 Protein (NBP1-86461PEP)
Read Publication using
NBP1-86461 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 22798501).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CYP4F2 Antibody

  • CPF2
  • Cytochrome P450 4F2
  • cytochrome P450, family 4, subfamily F, polypeptide 2
  • cytochrome P450, subfamily IVF, polypeptide 2
  • Cytochrome P450-LTB-omega
  • EC
  • leukotriene B4 omega-hydroxylase
  • Leukotriene-B(4) 20-monooxygenase 1
  • leukotriene-B(4) omega-hydroxylase 1
  • leukotriene-B4 20-monooxygenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CYP4F2 Antibody (NBP1-86461)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for CYP4F2 Antibody (NBP1-86461) (0)

There are no reviews for CYP4F2 Antibody (NBP1-86461). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP4F2 Antibody (NBP1-86461) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CYP4F2 Antibody (NBP1-86461)

Discover related pathways, diseases and genes to CYP4F2 Antibody (NBP1-86461). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4F2 Antibody (NBP1-86461)

Discover more about diseases related to CYP4F2 Antibody (NBP1-86461).

Pathways for CYP4F2 Antibody (NBP1-86461)

View related products by pathway.

PTMs for CYP4F2 Antibody (NBP1-86461)

Learn more about PTMs related to CYP4F2 Antibody (NBP1-86461).

Research Areas for CYP4F2 Antibody (NBP1-86461)

Find related products by research area.

Blogs on CYP4F2

There are no specific blogs for CYP4F2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CYP4F2 Antibody and receive a gift card or discount.


Gene Symbol CYP4F2