BTN2A1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BTN2A1 Antibody [NBP1-88504] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BTN2A1 Antibody [NBP1-88504] - Staining of human liver shows low positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: BTN2A1 Antibody [NBP1-88504] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: BTN2A1 Antibody [NBP1-88504] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: BTN2A1 Antibody [NBP1-88504] - Staining of human stomach shows weak to moderate membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BTN2A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTN2A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BTN2A1 Protein (NBP1-88504PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BTN2A1 Antibody - BSA Free

• BK14H9.1
• BT2.1
• BTF1
• BTF1BT2.1butyrophilin BTF1
• BTN2A1
• butyrophilin subfamily 2 member A1
• butyrophilin, subfamily 2, member A1
• DJ3E1.1
• FLJ36567

Background

The BTN2A1 gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin proteinfamily. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expandingB7/butyrophilin-like group, a su

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BTN2A1