BTN2A1 Antibody

Images

 
Western Blot: BTN2A1 Antibody [NBP1-88504] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: BTN2A1 Antibody [NBP1-88504] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: BTN2A1 Antibody [NBP1-88504] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTN2A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTN2A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BTN2A1 Protein (NBP1-88504PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTN2A1 Antibody

  • BK14H9.1
  • BT2.1
  • BTF1
  • BTF1BT2.1butyrophilin BTF1
  • BTN2A1
  • butyrophilin subfamily 2 member A1
  • butyrophilin, subfamily 2, member A1
  • DJ3E1.1
  • FLJ36567

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5747
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-02151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-88509
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB400-139
Species: Hu, Ha
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
259-HE
Species: Hu
NBP1-84056
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
259-HE
Species: Hu
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-02864
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90750
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BTN2A1 Antibody (NBP1-88504) (0)

There are no publications for BTN2A1 Antibody (NBP1-88504).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTN2A1 Antibody (NBP1-88504) (0)

There are no reviews for BTN2A1 Antibody (NBP1-88504). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BTN2A1 Antibody (NBP1-88504) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTN2A1 Products

Bioinformatics Tool for BTN2A1 Antibody (NBP1-88504)

Discover related pathways, diseases and genes to BTN2A1 Antibody (NBP1-88504). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTN2A1 Antibody (NBP1-88504)

Discover more about diseases related to BTN2A1 Antibody (NBP1-88504).
 

Pathways for BTN2A1 Antibody (NBP1-88504)

View related products by pathway.

PTMs for BTN2A1 Antibody (NBP1-88504)

Learn more about PTMs related to BTN2A1 Antibody (NBP1-88504).

Blogs on BTN2A1

There are no specific blogs for BTN2A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTN2A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTN2A1
Entrez