CD277/BTN3A1 Antibody - BSA Free

Western Blot: CD277/BTN3A1 Antibody [NBP1-90750] - Analysis in human cell line RPMI-8226.

Immunohistochemistry-Paraffin: CD277/BTN3A1 Antibody [NBP1-90750] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CD277/BTN3A1 Antibody [NBP1-90750] - Staining of human kidney shows strong granular cytoplasimc positivity in cells in tubules.

Immunohistochemistry-Paraffin: CD277/BTN3A1 Antibody [NBP1-90750] - Staining of human lymph node shows strong membranous positivity in non-germinal center and germinal center cells.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human lymph node shows strong membranous positivity in non-germinal center and germinal center cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human cell line RPMI-8226.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD277/BTN3A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD277/BTN3A1 Antibody - BSA Free (NBP1-90750) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-CD277/BTN3A1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTN3A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Simple Western 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: separated by Size, antibody dilution of 1:200
• Control Peptide:

  CD277/BTN3A1 Recombinant Protein Antigen (NBP1-90750PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD277/BTN3A1 Antibody - BSA Free

• BT3.1
• BTF5
• BTN3A1
• butyrophilin, subfamily 3, member A1
• CD277
• dJ45P21.3 (butyrophilin, subfamily 3, member A1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CD277/BTN3A1 Antibody (NBP1-90750)(3)

Publications using NBP1-90750

• Fischer K, Bradlerova M, Decker T, Supper V V?9+V?2+?T cell control of Listeria monocytogenes growth in infected epithelial cells requires butyrophilin 3A genes Scientific reports 2023-10-30 [PMID: 37903831] (WB, Human)
• Benelli R, Costa D, Salvini L et al. Targeting of colorectal cancer organoids with zoledronic acid conjugated to the anti-EGFR antibody cetuximab Journal for immunotherapy of cancer 2022-12-01 [PMID: 36543375] (WB, IHC-P, Human)
  
  Details:
  Dilution used in WB 1:500
• Zocchi MR, Costa D, Vene R et al. Zoledronate can induce colorectal cancer microenvironment expressing BTN3A1 to stimulate effector gammadelta T cells with antitumor activity. Oncoimmunology. 2017-01-06 [PMID: 28405500] (WB, Human)
  
  Details:
  This citation used the HRP form of this antbody

Review for CD277/BTN3A1 Antibody (NBP1-90750) (1)

Average Rating: 2

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Boyan Zhang WB Human 09/07/2021

Summary

• Application: Western Blot
• Sample Tested: Cell Lysates
• Species: Human
• Lot: 000015488

Bioinformatics

• Gene Symbol: BTN3A1