BTBD12 Antibody

Images

 
Immunohistochemistry: BTBD12 Antibody [NBP2-39070] - Staining of human cervix, uterine shows moderate nucleolar positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTBD12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRA
Specificity
Specificity of human BTBD12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BTBD12 Protein (NBP2-39070PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTBD12 Antibody

  • BTB (POZ) domain containing 12
  • BTB/POZ domain-containing protein 12
  • BTBD12structure-specific endonuclease subunit SLX4
  • KIAA1784MUS312
  • KIAA1987FANCP
  • SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2064
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IP, CyTOF-ready
H00146956-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-214
Species: Hu, Mu
Applications: WB, IP
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-621
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56320
Species: Hu
Applications: WB
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-42677
Species: Hu
Applications: WB, IHC-P, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39070
Species: Hu
Applications: IHC, IHC-P

Publications for BTBD12 Antibody (NBP2-39070) (0)

There are no publications for BTBD12 Antibody (NBP2-39070).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD12 Antibody (NBP2-39070) (0)

There are no reviews for BTBD12 Antibody (NBP2-39070). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BTBD12 Antibody (NBP2-39070) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BTBD12 Antibody (NBP2-39070)

Discover related pathways, diseases and genes to BTBD12 Antibody (NBP2-39070). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTBD12 Antibody (NBP2-39070)

Discover more about diseases related to BTBD12 Antibody (NBP2-39070).
 

Pathways for BTBD12 Antibody (NBP2-39070)

View related products by pathway.

PTMs for BTBD12 Antibody (NBP2-39070)

Learn more about PTMs related to BTBD12 Antibody (NBP2-39070).

Blogs on BTBD12

There are no specific blogs for BTBD12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTBD12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLX4
Uniprot