BRIX Antibody - BSA Free

Western Blot: BRIX Antibody [NBP1-91708] - Analysis in human cell line SiHa.

Immunocytochemistry/Immunofluorescence: BRIX Antibody [NBP1-91708] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BRIX Antibody [NBP1-91708] - Staining of human colon shows moderate positivity in nucleoli in glandular cells.

Immunohistochemistry-Paraffin: BRIX Antibody [NBP1-91708] - Staining of human fallopian tube shows strong postivity in nucleoli in glandular cells.

Immunohistochemistry-Paraffin: BRIX Antibody [NBP1-91708] - Staining of human prostate shows moderate postivity in nucleoli in glandular cells.

Immunohistochemistry-Paraffin: BRIX Antibody [NBP1-91708] - Staining of human cerrebellum shows moderate positivity in nucleoli in Purkinje cells and in cells in molecular layer.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line SiHa.

Staining of human fallopian tube shows strong positivity in nucleoli in glandular cells.

Staining of human prostate shows moderate positivity in nucleoli in glandular cells.

Staining of human cerebellum shows moderate positivity in nucleoli in Purkinje cells and in cells in molecular layer.

• Reactivity: Hu, Mu, Rt, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BRIX Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYK
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRIX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BRIX Protein (NBP1-91708PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BRIX Antibody - BSA Free

• brix domain containing 2
• Brix domain-containing protein 2
• BRIX
• BRIX1
• BRIXBXDC2
• BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
• BXDC2
• FLJ11100
• ribosome biogenesis protein BRX1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BRIX Antibody (NBP1-91708)(1)

Publication using NBP1-91708

• Emechebe U, Giraud D, Ammi AY et al. Phosphoproteomic response of cardiac endothelial cells to ischemia and ultrasound Biochimica et biophysica acta. Proteins and proteomics 2021-06-11 [PMID: 34119693]

Bioinformatics

• Gene Symbol: BRIX1