Brg1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Brg1 Antibody [NBP2-92957] - Analysis of HeLa cells using Brg1 .

Western Blot: Brg1 Antibody [NBP2-92957] - Analysis of extracts from normal (control) and SMARCA4 knockout (KO) 293T cells, using Brg1 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Western Blot: Brg1 Antibody - BSA Free [NBP2-92957] - Western blot analysis of lysates from Hep G2 cells using [KO Validated] Brg1 Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ICC/IF, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Brg1 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit Brg1 Antibody - BSA Free (NBP2-92957) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 30-130 of human Brg1 (NP_003063.2). PSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:20 - 1:50
  • Knockout Validated
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Brg1 Antibody - BSA Free

• ATP-dependent helicase SMARCA4
• BAF190
• BAF190A
• brahma protein-like 1
• Brg1
• BRG1-associated factor 190A
• BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 4
• BRM/SWI2-related gene 1
• EC 3.6.1
• EC 3.6.4.-
• FLJ39786
• global transcription activator homologous sequence
• homeotic gene regulator
• hSNF2b
• Mitotic growth and transcription activator
• nuclear protein GRB1
• Protein brahma homolog 1
• Protein BRG-1
• RTPS2
• SMARCA4
• SNF2
• SNF2B
• SNF2-beta
• SNF2L4
• SNF2LB
• SNF2-like 4
• subfamily a, member 4
• sucrose nonfermenting-like 4
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI2
• transcription activator BRG1

Background

BRG1 is encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Alternatively spliced transcripts have been found for this gene, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCA4