BRDG1/STAP-1 Antibody - BSA Free

Staining of human cell line HEL shows localization to mitochondria & centriolar satellites.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BRDG1/STAP-1 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein BRDG1/STAP-1 using the following amino acid sequence: NYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BRDG1/STAP-1 Antibody - BSA Free

• BCR downstream-signaling protein 1
• BRDG1
• BRDG1STAP-1BCR downstream signaling 1
• Docking protein BRDG1
• signal transducing adaptor family member 1
• signal-transducing adaptor protein 1
• signal-transducing adaptor protein-1
• STAP1
• Stem cell adaptor protein 1

Background

STAP-1 is encoded by this gene functions as a docking protein acting downstream of Tec tyrosine kinase in B cell antigen receptor signaling. The protein is directly phosphorylated by Tec in vitro where it participates in a postive feedback loop, increasing Tec activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAP1