BPGM Antibody - BSA Free

Immunohistochemistry-Paraffin: BPGM Antibody [NBP1-86064] - Analysis in human placenta and liver tissues using NBP1-86064 antibody. Corresponding BPGM RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: BPGM Antibody [NBP1-86064] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: BPGM Antibody [NBP1-86064] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: BPGM Antibody [NBP1-86064] - Staining of human urinary bladder shows weak to moderate cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: BPGM Antibody [NBP1-86064] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line U-251 MG.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BPGM Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BPGM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: IHC-P, Retrieval method: HIER pH6.
• Control Peptide:

  BPGM Recombinant Protein Antigen (NBP1-86064PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BPGM Antibody - BSA Free

• 2,3-bisphosphoglycerate mutase
• bisphosphoglycerate mutase
• BPG-dependent PGAM
• EC 3.1.3.132,3-bisphosphoglycerate synthase
• EC 5.4.2.1
• EC 5.4.2.4
• erythrocyte 2,3-bisphosphoglycerate mutase2,3-bisphosphoglycerate mutase, erythrocyte

Background

2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds toand decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPGsynthesis via its synthetase activity, and 2,3-DPG degradation via its phosphatase activity. The enzyme also hasphosphoglycerate phosphomutase activity. Deficiency of this enzyme increases the affinity of cells for oxygen.Mutations in this gene result in hemolytic anemia. Multiple alternatively spliced variants, encoding the same protein,have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BPGM Antibody (NBP1-86064)(3)

Publications using NBP1-86064

• Balcerek B, Steinach M, Lichti J et al. A broad diversity in oxygen affinity to haemoglobin Sci Rep 2020-10-09 [PMID: 33037242] (WB, Human)
• Steinemann G, Dittmer A, Schmidt J, et al. Antitumor and antiangiogenic activity of the novel chimeric inhibitor animacroxam in testicular germ cell cancer Mol Oncol 2019-12-01 [PMID: 31583820] (WB, Mouse, Human)
• Bachmann J, Burte F, Pramana S et al. Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria. PLoS Pathog 2014-04-01 [PMID: 24743550]

Bioinformatics

• Gene Symbol: BPGM