| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BP1 (NP_001925). Peptide sequence ERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVS |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DLX4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BP1 Antibody (NBP3-10328)Find related products by research area.
|
|
BRCA1 - A Critical Tumor Suppressor Gene in Women Breast cancer 1, early onset (BRCA1) is a well-known tumor suppressor gene that was originally discovered due to its link with early-onset breast and ovarian cancer in women. The BRCA1 protein contains the following domains: RING finger, RAD51-interac... Read full blog post. |
|
BP1 Antibodies, Beta Globin and Breast Cancer: Today's post is brought to you by the letter 'B' The transcription factor beta protein 1 (BP1) is a member of the homeobox gene family and the distal-less subfamily. Expression of BP1 is highly tissue-specific and developmentally restricted. Among different human tissues, BP1 is found to be highly e... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DLX4 |