Borealin Antibody - BSA Free

Analysis in human testis and prostate tissues using NBP1-89949 antibody. Corresponding CDCA8 RNA-seq data are presented for the same tissues.

Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Staining of human prostate shows no positivity in glandular cells as expected.

Staining of human lymph node shows moderate nuclear positivity in subset of germinal center cells.

Staining of human skin shows moderate nuclear positivity in subset of squamous epithelial cells.

Analysis in control (vector only transfected HEK293T lysate) and CDCA8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-251 MG

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Borealin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Borealin Antibody - BSA Free (NBP1-89949) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDCA8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Borealin Protein (NBP1-89949PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Borealin Antibody - BSA Free

• BOR
• BOREALIN
• cell division cycle associated 8
• Cell division cycle-associated protein 8
• Dasra B
• DasraB
• dasra-B
• FLJ10468
• FLJ12042
• hDasra-B
• MESRGP
• PESCRG3
• Pluripotent embryonic stem cell-related gene 3 protein

Background

Borealin (CDCA8) is a component of the chromosomal passenger complex (CPC), which is required for stability of the bipolar mitotic spindle and acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA.

Borealin has been shown to interact with Aurora B and survivin (BIRC5). Knockdown of Borealin by small interfering RNA resulted in severe chromosome misalignment at metaphase and accumulation of multiple interphase nuclei. Borealin is also related to the proliferation of human embryonic stem (hES) cells and is highly expressed in mouse undifferentiated ES cells.
Borealin antibodies are useful tools for stem cell studies and cell division research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDCA8