Reactivity | Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human BNIPLThe immunogen for this antibody is BNIPL. Peptide sequence AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | BNIPL |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against BNIPL and was validated on Western blot. |
|
Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-79502 | Applications | Species |
---|---|---|
Gao L, Liu H, Yin N et al. BNIPL 2 expression is correlated with the prognosis and regulates the proliferation of colorectal cancer through CD44 Mol Med Rep Sep 2 2019 [PMID: 31485655] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for BNIPL Antibody (NBP1-79502)Discover more about diseases related to BNIPL Antibody (NBP1-79502).
| Pathways for BNIPL Antibody (NBP1-79502)View related products by pathway.
|
PTMs for BNIPL Antibody (NBP1-79502)Learn more about PTMs related to BNIPL Antibody (NBP1-79502).
| Research Areas for BNIPL Antibody (NBP1-79502)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.