BNIPL Antibody

Images

 
Western Blot: BNIPL Antibody [NBP1-79502] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BNIPL Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human BNIPLThe immunogen for this antibody is BNIPL. Peptide sequence AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BNIPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against BNIPL and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-79502 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BNIPL Antibody

  • bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
  • BCL2/adenovirus E1B 19kD interacting protein like
  • BNIP-2 similar
  • BNIPL-1
  • BNIPL-2
  • BNIP-S
  • PP753

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15602
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NB100-56663
Species: Hu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB7940
Species: Hu
Applications: WB, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-79502
Species: Hu
Applications: WB

Publications for BNIPL Antibody (NBP1-79502)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for BNIPL Antibody (NBP1-79502) (0)

There are no reviews for BNIPL Antibody (NBP1-79502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BNIPL Antibody (NBP1-79502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BNIPL Products

Bioinformatics Tool for BNIPL Antibody (NBP1-79502)

Discover related pathways, diseases and genes to BNIPL Antibody (NBP1-79502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNIPL Antibody (NBP1-79502)

Discover more about diseases related to BNIPL Antibody (NBP1-79502).
 

Pathways for BNIPL Antibody (NBP1-79502)

View related products by pathway.

PTMs for BNIPL Antibody (NBP1-79502)

Learn more about PTMs related to BNIPL Antibody (NBP1-79502).
 

Research Areas for BNIPL Antibody (NBP1-79502)

Find related products by research area.

Blogs on BNIPL

There are no specific blogs for BNIPL, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNIPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BNIPL
Uniprot
Novus 100% Guarantee