![Western Blot: BNIPL Antibody [NBP1-79502] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/BNIPL Antibody-Western Blot-NBP1-79502-img0002.jpg "Western Blot: BNIPL Antibody [NBP1-79502] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human BNIPLThe immunogen for this antibody is BNIPL. Peptide sequence AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY. The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BNIPL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This is a rabbit polyclonal antibody against BNIPL and was validated on Western blot. |
|
| Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-79502 | Applications | Species |
|---|---|---|
| Gao L, Liu H, Yin N et al. BNIPL 2 expression is correlated with the prognosis and regulates the proliferation of colorectal cancer through CD44 Mol Med Rep Sep 2 2019 [PMID: 31485655] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for BNIPL Antibody (NBP1-79502)Discover more about diseases related to BNIPL Antibody (NBP1-79502).
| Pathways for BNIPL Antibody (NBP1-79502)View related products by pathway.
|
PTMs for BNIPL Antibody (NBP1-79502)Learn more about PTMs related to BNIPL Antibody (NBP1-79502).
| Research Areas for BNIPL Antibody (NBP1-79502)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: BNIP2 Antibody [NBP2-15602] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with BNIP2 antibody diluted by 1:1000.](http://images.novusbio.com/images2/BNIP2-Antibody-Western-Blot-NBP2-15602-img0003.jpg)
![Immunohistochemistry-Paraffin: BNIP2 Antibody [NBP2-15602] - Immunohistochemical analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/BNIP2 Antibody-Immunohistochemistry-Paraffin-NBP2-15602-img0002.jpg)
![Western Blot: BNIP2 Antibody [NBP2-15602] - Sample (30 ug of whole cell lysate) A: HepG2 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/BNIP2 Antibody-Western Blot-NBP2-15602-img0001.jpg)
![Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.](http://images.novusbio.com/images2/Bcl-2-Antibody-Western-Blot-NB100-56098-img0004.jpg)
![Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).](http://images.novusbio.com/images2/Bcl-2-Antibody-Western-Blot-NB100-56098-img0007.jpg)
![Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - Analysis of a FFPE human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.](http://images.novusbio.com/images2/Bcl-2-Antibody-Immunohistochemistry-Paraffin-NB100-56098-img0011.jpg)
![Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ARHGAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/images2/ARHGAP1-Antibody-Western-Blot-NBP1-85724-img0018.jpg)
![Immunocytochemistry/Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/ARHGAP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85724-img0017.jpg)
![Immunohistochemistry-Paraffin: ARHGAP1 Antibody [NBP1-85724] - Staining of human hippocampus shows positivity in neuropil.](http://images.novusbio.com/images2/ARHGAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-85724-img0007.jpg)
![Western Blot: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of CDC42 on different lysates using anti-CDC42 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Jurkat Lane 3: HepG2](http://images.novusbio.com/images2/CDC42 Antibody (JJ086-04)-Western Blot-NBP2-67895-img0005.jpg)
![Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded mouse pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/CDC42-Antibody-(JJ086-04)-Immunohistochemistry-Paraffin-NBP2-67895-img0004.jpg)
![Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.](http://images.novusbio.com/images2/CDC42-Antibody-(JJ086-04)-Flow-Cytometry-NBP2-67895-img0001.jpg)
![MIF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "MIF [Unconjugated]")
![Western Blot: Bcl rambo Antibody [NBP1-90002] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/images2/Bcl-rambo-Antibody-Western-Blot-NBP1-90002-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Bcl rambo Antibody [NBP1-90002] - Staining of human cell line HaCaT shows localization to mitochondria.](http://images.novusbio.com/images2/Bcl-rambo-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90002-img0005.jpg)
![Immunohistochemistry-Paraffin: Bcl rambo Antibody [NBP1-90002] - Staining of human smooth muscle shows strong cytoplasmic positivity was observed in smooth muscle cells.](http://images.novusbio.com/images2/Bcl-rambo-Antibody-Immunohistochemistry-Paraffin-NBP1-90002-img0002.jpg)
![Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).](http://images.novusbio.com/images2/beta-Galactosidase-1-GLB1-Antibody-(1C9)-Western-Blot-NBP2-45731-img0016.jpg)
![Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/images2/beta-Galactosidase-1-GLB1-Antibody-(1C9)-Immunohistochemistry-NBP2-45731-img0013.jpg)
![Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLB1.](http://images.novusbio.com/images2/beta-Galactosidase-1-GLB1-Antibody-(1C9)-Western-Blot-NBP2-45731-img0014.jpg)
![Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Lung Carcinoma stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)](http://images.novusbio.com/images2/TTF-1---NKX2-1-Antibody-(8G7G3-1-+-NX2.1-690)-Immunohistochemistry-Paraffin-NBP2-44501-img0001.jpg)
![Immunohistochemistry: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - TTF1 staining in thyroid tissue of wild-type C57 mouse (red). Dilution is 1:100. Image from a verified customer review.](http://images.novusbio.com/images2/TTF-1---NKX2-1-Antibody-(8G7G3-1-+-NX2.1-690)-Immunohistochemistry-NBP2-44501-img0003.jpg)
![Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Thyroid stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)](http://images.novusbio.com/images2/TTF-1---NKX2-1-Antibody-(8G7G3-1-+-NX2.1-690)-Immunohistochemistry-Paraffin-NBP2-44501-img0002.jpg)
![Flow Cytometry: Annexin V Apoptosis Kit [FITC] [NBP2-29373] - Controls run before the experimental samples are analyzed, to adjust the fluorescent compensation on the flow cytometer due to the FITC signal from the Annexin V-FITC bleeding into the Propidium Iodide signal.](http://images.novusbio.com/images2/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry: Annexin V Apoptosis Kit [FITC] [NBP2-29373] - Adherent RAW cells treated with actinomycin-D, detached with a cell detachment solution and stained with the Annexin V Apoptosis Kit [FITC].](http://images.novusbio.com/images2/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Immunohistochemistry-Paraffin: Chimaerin 2 Antibody [NBP1-36945] - 3.8ug/ml staining of paraffin embedded Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images/Chimaerin 2 Antibody-Immunohistochemistry-Paraffin-NBP1-36945-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of paraffin-embedded human lung cancer tissues using anti-CD44 mAb (green), showing membrane localization. DRAQ5 fluorescent DNA dye (blue).](http://images.novusbio.com/images2/CD44-Antibody-(8E2F3)-Immunocytochemistry-Immunofluorescence-NBP1-47386-img0011.jpg)
![Immunohistochemistry-Paraffin: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of FFPE human breast carcinoma tissues using CD44 antibody (8E2F3). The signal was developed using DAB based detection and the sections were processed for counterstaining with hematoxylin. The antibody generated mainly a membrane staining representative of CD44 protein.](http://images.novusbio.com/images2/CD44-Antibody-(8E2F3)-Immunohistochemistry-Paraffin-NBP1-47386-img0014.jpg)
![Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of HeLa cells using anti-CD44 mAb (right) and negative control (left).](http://images.novusbio.com/images2/CD44-Antibody-(8E2F3)-Flow-Cytometry-NBP1-47386-img0008.jpg)
![Western Blot: RhoA Antibody [NB100-91273] - Rat spinal cord lysate using Rabbit antibody to Transforming protein RhoA: whole serum at 1:2000 dilution. One single band is detected.](http://images.novusbio.com/images2/RhoA-Antibody-Western-Blot-NB100-91273-img0034.jpg)
![Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.](http://images.novusbio.com/images2/RhoA-Antibody-Immunocytochemistry-Immunofluorescence-NB100-91273-img0024.jpg)
![Immunohistochemistry: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin sections) using Rabbit antibody to RhoA at a concentration of 15 ug/ml, incubated overnight and developed with DAB Ni.](http://images.novusbio.com/images2/RhoA Antibody-Immunohistochemistry-NB100-91273-img0040.jpg)
![Western Blot: IKK beta Antibody (10AG2) [NB100-56509] - Analysis of A) human Daudi, B) HeLa, and C) mouse NIH3T3 lysate probed with IKKbeta antibody at 2 ug/ml.](http://images.novusbio.com/images2/IKK-beta-Antibody-(10AG2)-Western-Blot-NB100-56509-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: IKK beta Antibody (10AG2) [NB100-56509] - U-87 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-IKK beta Antibody (10AG2) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/IKK-beta-Antibody-(10AG2)-Immunocytochemistry-Immunofluorescence-NB100-56509-img0013.jpg)
![Immunohistochemistry-Paraffin: IKK beta Antibody (10AG2) [NB100-56509] - Analysis of a FFPE tissue section of human placenta using 1:200 dilution of IKK beta clone 10AG2 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.](http://images.novusbio.com/images2/IKK-beta-Antibody-(10AG2)-Immunohistochemistry-Paraffin-NB100-56509-img0014.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")