Home » BNIPL » BNIPL Antibodies » BNIPL Antibody

BNIPL Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: BNIPL Antibody [NBP1-79502] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: BNIPL Antibody [NBP1-79502] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BNIPL Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human BNIPLThe immunogen for this antibody is BNIPL. Peptide sequence AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BNIPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against BNIPL and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-79502 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BNIPL Antibody

  • bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
  • BCL2/adenovirus E1B 19kD interacting protein like
  • BNIP-2 similar
  • BNIPL-1
  • BNIPL-2
  • BNIP-S
  • PP753

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BNIP2 Antibody
NBP1-88559
Immunohistochemistry-Paraffin: BNIP2 Antibody [NBP1-88559] - Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: BNIP2 Antibody [NBP1-88559] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: BNIP2 Antibody [NBP1-88559] - Staining of human placenta show strong cytoplasmic positivity in trophoblastic cells.
Species: Hu
Applications: IHC, IHC-P, WB
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(13 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ARHGAP1 Antibody
NBP1-85724
Immunocytochemistry/Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ARHGAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ARHGAP1 Antibody [NBP1-85724] - Staining of human hippocampus shows positivity in neuropil.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded human pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
MIF [Unconjugated]
289-MF
MIF [Unconjugated]
(28 Publications)
Species: Hu
Applications: BA
Bcl rambo Antibody
NBP1-90002
Immunohistochemistry-Paraffin: Bcl rambo Antibody [NBP1-90002] - Staining of human smooth muscle shows strong cytoplasmic positivity was observed in smooth muscle cells.
Western Blot: Bcl rambo Antibody [NBP1-90002] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: Bcl rambo Antibody [NBP1-90002] - Staining of human cell line HaCaT shows localization to mitochondria.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - TTF1 staining in thyroid tissue of wild-type C57 mouse (red). Dilution is 1:100. Image from a verified customer review.
Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Thyroid stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Lung Carcinoma stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Annexin V
Apoptosis Kit [FITC]
NBP2-29373
Flow Cytometry: Annexin V Apoptosis Kit [FITC] [NBP2-29373] - Adherent RAW cells treated with actinomycin-D, detached with a cell detachment solution and stained with the Annexin V Apoptosis Kit [FITC].
Flow Cytometry: Annexin V Apoptosis Kit [FITC] [NBP2-29373] - Controls run before the experimental samples are analyzed, to adjust the fluorescent compensation on the flow cytometer due to the FITC signal from the Annexin V-FITC bleeding into the Propidium Iodide signal.
Flow Cytometry: Annexin V Apoptosis Kit [FITC] [NBP2-29373] - Flow cytometry image submitted by a verified customer review.
(2 Reviews)
(28 Publications)
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
Chimaerin 2
Antibody
NBP1-36945
Immunohistochemistry-Paraffin: Chimaerin 2 Antibody [NBP1-36945] - 3.8ug/ml staining of paraffin embedded Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
IL-5 [HRP]
M5000
(3 Reviews)
(77 Publications)
Species: Mu
Applications: ELISA
GFER/ALR Antibody
(829812)
MAB7940
GFER/ALR was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human GFER/ALR Monoclonal Antibody (Catalog # MAB7940) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to cytoplasm of hepatocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and Hep3B human hepatocellular carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human GFER/ALR Monoclonal Antibody (Catalog # MAB7940) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for GFER/ALR at approximately 20-24 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: IHC, WB
Clusterin/APOJ
[HRP]
DCLU00
(2 Reviews)
(11 Publications)
Species: Hu
Applications: ELISA
CD44 Antibody
(8E2F3)
NBP1-47386
Western Blot: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis using anti-CD44 mAb against truncated Trx-CD44 recombinant protein (1) and GST-CD44 (aa628-699) recombinant protein (2).
Flow (Intracellular): CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(16 Publications)
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(10 Reviews)
(46 Publications)
Species: Hu
Applications: BA
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(2 Publications)
Species: Hu
Applications: BA
RhoA Antibody
NB100-91273
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry-Paraffin: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin section) using Rabbit antibody to Transforming protein RhoA (Arha, Arha2): whole serum at 1 : 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
(1 Review)
(3 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IKK beta Antibody
(10AG2)
NB100-56509
Flow Cytometry: IKK beta Antibody (10AG2) [NB100-56509] - Analysis of PE conjugate of NB100-56509. An intracellular stain was performed on Jurkat cells with IKK Beta antibody (10AG2) NB100-56509PE (blue) and a matched isotype control NBP2-27287AF488 (orange). Cells were fixed with 4% PFA and then permeablized wi
Immunocytochemistry/Immunofluorescence: IKK beta Antibody (10AG2) [NB100-56509] - U-87 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-IKK beta Antibody (10AG2) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: IKK beta Antibody (10AG2) [NB100-56509] - Analysis using the Alexa Fluor (R) 488 conjugate of NB100-56509. Staining of IKKbeta in HEK 293 cells using 0.1 ug of Alexa Fluor 488-conjugated antibody. Green histogram represents the isotype control , red represents the IKKbeta antibody.
(1 Review)
(56 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Publications for BNIPL Antibody (NBP1-79502)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for BNIPL Antibody (NBP1-79502) (0)

There are no reviews for BNIPL Antibody (NBP1-79502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BNIPL Antibody (NBP1-79502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional BNIPL Products

Bioinformatics Tool for BNIPL Antibody (NBP1-79502)

Discover related pathways, diseases and genes to BNIPL Antibody (NBP1-79502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNIPL Antibody (NBP1-79502)

Discover more about diseases related to BNIPL Antibody (NBP1-79502).
 

Pathways for BNIPL Antibody (NBP1-79502)

View related products by pathway.

PTMs for BNIPL Antibody (NBP1-79502)

Learn more about PTMs related to BNIPL Antibody (NBP1-79502).
 

Research Areas for BNIPL Antibody (NBP1-79502)

Find related products by research area.

Blogs on BNIPL

There are no specific blogs for BNIPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNIPL Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol BNIPL
Uniprot