BNC1 Antibody

Images

 
Western Blot: BNC1 Antibody [NBP1-68996] - Mouse Intestine, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BNC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Bnc1 (basonuclin 1) The peptide sequence was selected from the C terminal of Bnc1. Peptide sequence ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BNC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Bnc1 and was validated on Western blot.
Theoretical MW
110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BNC1 Antibody

  • basonuclin 1
  • basonuclin
  • BNC
  • BSN1
  • HsT19447
  • zinc finger protein basonuclin
  • zinc finger protein basonuclin-1

Background

The function of Bnc1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46376
Species: Hu
Applications: WB, IHC
NBP1-88501
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB300-188
Species: Rt
Applications: IHC, IHC-P
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP1-46288
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
1670-SE
Species: Ec
NBP2-22409
Species: Mu
Applications: WB, ICC/IF, IHC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB5545
Species: Hu
Applications: WB
NBP1-68996
Species: Mu
Applications: WB

Publications for BNC1 Antibody (NBP1-68996) (0)

There are no publications for BNC1 Antibody (NBP1-68996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNC1 Antibody (NBP1-68996) (0)

There are no reviews for BNC1 Antibody (NBP1-68996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BNC1 Antibody (NBP1-68996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BNC1 Products

Bioinformatics Tool for BNC1 Antibody (NBP1-68996)

Discover related pathways, diseases and genes to BNC1 Antibody (NBP1-68996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNC1 Antibody (NBP1-68996)

Discover more about diseases related to BNC1 Antibody (NBP1-68996).
 

Pathways for BNC1 Antibody (NBP1-68996)

View related products by pathway.

PTMs for BNC1 Antibody (NBP1-68996)

Learn more about PTMs related to BNC1 Antibody (NBP1-68996).

Blogs on BNC1

There are no specific blogs for BNC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BNC1