BNC1 Antibody - BSA Free

Western Blot: BNC1 Antibody [NBP1-68996] - Mouse Intestine, concentration 0.2-1 ug/ml.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BNC1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to Bnc1 (basonuclin 1) The peptide sequence was selected from the C terminal of Bnc1. Peptide sequence ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BNC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 110 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BNC1 Antibody - BSA Free

• basonuclin 1
• basonuclin
• BNC
• BSN1
• HsT19447
• zinc finger protein basonuclin
• zinc finger protein basonuclin-1

Background

The function of Bnc1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BNC1