BMP-6 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY |
| Predicted Species |
Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BMP6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for BMP-6 Antibody - BSA Free
Background
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Publications for BMP-6 Antibody (NBP2-57272) (0)
There are no publications for BMP-6 Antibody (NBP2-57272).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BMP-6 Antibody (NBP2-57272) (0)
There are no reviews for BMP-6 Antibody (NBP2-57272).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for BMP-6 Antibody (NBP2-57272) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional BMP-6 Products
Research Areas for BMP-6 Antibody (NBP2-57272)
Find related products by research area.
|
Blogs on BMP-6