BMP-15/GDF-9B Antibody (6K5C3)

Western Blot: BMP-15/GDF-9B Antibody (6K5C3) [NBP3-16342] - Western blot analysis of extracts of various cell lines, using BMP-15/GDF-9B Rabbit mAb (NBP3-16342) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Western Blot: BMP-15/GDF-9B Antibody (6K5C3) [NBP3-16342] - Western blot analysis of extracts of Rat ovary, using BMP-15/GDF-9B Rabbit mAb (NBP3-16342) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 6K5C3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

BMP-15/GDF-9B Antibody (6K5C3) Summary

• Description: Novus Biologicals Rabbit BMP-15/GDF-9B Antibody (6K5C3) (NBP3-16342) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 293-392 of human BMP-15/GDF-9B (O95972). LHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: BMP15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BMP-15/GDF-9B Antibody (6K5C3)

• BMP15
• BMP-15
• bone morphogenetic protein 15
• GDF-9B
• Growth/differentiation factor 9B
• ODG2
• POF4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BMP15