Blooms Syndrome Protein Blm Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Blooms Syndrome Protein Blm Antibody [NBP1-89929] - Staining of human cell line A-431 shows positivity in nucleus and cytoplasm.
Immunohistochemistry-Paraffin: Blooms Syndrome Protein Blm Antibody [NBP1-89929] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Blooms Syndrome Protein Blm Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BLM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Western data from customer review.
Control Peptide
Blooms Syndrome Protein Blm Protein (NBP1-89929PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-89929 in the following applications:

Publications
Read Publications using
NBP1-89929 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23908689).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Blooms Syndrome Protein Blm Antibody

  • Bloom syndrome
  • Bloom syndrome, RecQ helicase-like
  • BSBloom syndrome protein
  • DNA helicase, RecQ-like type 2
  • EC 3.6.1
  • EC 3.6.4.12
  • MGC126616
  • MGC131618
  • RecQ protein-like 3
  • RecQ2
  • RECQ2MGC131620
  • RECQL3RECQL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-35213
Species: Hu
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF4715
Species: Mu
Applications: WB
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
MAB4077
Species: Hu
Applications: WB, IHC
AF6108
Species: Hu
Applications: IHC
NB100-1720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Blooms Syndrome Protein Blm Antibody (NBP1-89929)(3)

Review for Blooms Syndrome Protein Blm Antibody (NBP1-89929) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-89929:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Blooms Syndrome Protein Blm NBP1-89929
Enlarge
reviewed by:
Anonymous
WB Human 08/26/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
Special ApplicationsBLM antibody western on MCF7,231,436,468 breast cancer cell lines.
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Blooms Syndrome Protein Blm Antibody (NBP1-89929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Blooms Syndrome Protein Blm Products

Bioinformatics Tool for Blooms Syndrome Protein Blm Antibody (NBP1-89929)

Discover related pathways, diseases and genes to Blooms Syndrome Protein Blm Antibody (NBP1-89929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blooms Syndrome Protein Blm Antibody (NBP1-89929)

Discover more about diseases related to Blooms Syndrome Protein Blm Antibody (NBP1-89929).
 

Pathways for Blooms Syndrome Protein Blm Antibody (NBP1-89929)

View related products by pathway.

PTMs for Blooms Syndrome Protein Blm Antibody (NBP1-89929)

Learn more about PTMs related to Blooms Syndrome Protein Blm Antibody (NBP1-89929).
 

Research Areas for Blooms Syndrome Protein Blm Antibody (NBP1-89929)

Find related products by research area.

Blogs on Blooms Syndrome Protein Blm

There are no specific blogs for Blooms Syndrome Protein Blm, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/26/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol BLM