Blooms Syndrome Protein Blm Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Blooms Syndrome Protein Blm Antibody [NBP1-89929] - Staining of human cell line A-431 shows positivity in nucleus and cytoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Blooms Syndrome Protein Blm Antibody [NBP1-89929] - Staining of human stomach shows strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Blooms Syndrome Protein Blm Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Blooms Syndrome Protein Blm Antibody - BSA Free (NBP1-89929) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Blooms Syndrome Protein Blm Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BLM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Validated from a verified customer review.
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Blooms Syndrome Protein Blm Protein (NBP1-89929PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Blooms Syndrome Protein Blm Antibody - BSA Free

• BLM
• Bloom syndrome
• Bloom syndrome, RecQ helicase-like
• Blooms Syndrome Protein Blm
• BSBloom syndrome protein
• DNA helicase, RecQ-like type 2
• EC 3.6.1
• EC 3.6.4.12
• MGC126616
• MGC131618
• RecQ protein-like 3
• RecQ2
• RECQ2MGC131620
• RECQL3
• RECQL3RECQL2

Background

The Bloom's syndrome gene, BLM, plays an important role in the maintenance of genomic stability in somatic cells. The BLM protein is a 1417 amino acid peptide with homology to the RecQ helicases, a subfamily of DexH-box-containing DNA and RNA helicases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Blooms Syndrome Protein Blm Antibody (NBP1-89929)(4)

Publications using NBP1-89929

• Feng S, Qian X, Feng D, Zhang X Downregulation of BLM RecQ helicase inhibits proliferation, promotes the apoptosis and enhances the sensitivity of bladder cancer cells to cisplatin Molecular medicine reports 2022-10-01 [PMID: 36004459] (IF/IHC, Human)
  
  Details:
  Dilution used for IHC 1:100
• Meena JK, Cerutti A, Beichler C et al. Telomerase abrogates aneuploidy-induced telomere replication stress, senescence and cell depletion. EMBO J 2015-05-12 [PMID: 25820263] (ICC/IF, Human)
• Arora A, Abdel-Fatah TM, Agarwal D et al. Transcriptomic and protein expression analysis reveals clinicopathological significance of Bloom's syndrome helicase (BLM) in breast cancer Mol. Cancer Ther. 2015-02-11 [PMID: 25673821] (WB, Human)
• Lao VV, Welcsh P, Luo Y et al. Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers. Transl Oncol 2013-08-01 [PMID: 23908689] (IF/IHC, WB, Human)

Review for Blooms Syndrome Protein Blm Antibody (NBP1-89929) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 08/26/2014

Summary

• Application: Western Blot
• Species: Human

Bioinformatics

• Gene Symbol: BLM