Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free

Western Blot: Blood Group B Transferase/GTB/ABO Antibody (1B7) [H00000028-M08] - Analysis of ABO expression in A-431.

ELISA: Blood Group B Transferase/GTB/ABO Antibody (1B7) [H00000028-M08] - Detection limit for recombinant GST tagged ABO is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1B7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ABO (NP_065202.2, 273 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
• Specificity: This product is specific for Human ABO monoclonal antibody (M08), clone 1B7 [Gene ID: 28].
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ABO
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free

• A transferase
• A3GALNT
• A3GALT1
• ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase;transferase B, alpha 1-3-galactosyltransferase)
• ABO glycosyltransferase
• ABO
• B transferase
• B(A) alpha-1,3-galactosyltransferase
• EC 2.4.1.37
• EC 2.4.1.40
• Fucosylglycoprotein 3-alpha-galactosyltransferase
• Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase
• Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
• Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
• GTB
• Histo-blood group A transferase
• histo-blood group A2 transferase
• histo-blood group ABO system transferase
• Histo-blood group B transferase
• NAGAT

Background

The ABO gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in anindividual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near theN-terminus of the protein which resu

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABO
• Uniprot:
  • NP_065202.2(Human)