BLNK Antibody

Images

 
Immunohistochemistry: BLNK Antibody [NBP2-14356] - Staining of human spleen shows moderate cytoplasmic and nuclear positivity in cells in white pulp.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BLNK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEAD YVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BLNK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BLNK Protein (NBP2-14356PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BLNK Antibody

  • AGM4
  • B cell linker protein
  • BASH
  • B-cell adapter containing a SH2 domain protein
  • B-cell adapter containing a Src homology 2 domain protein
  • B-cell linker protein
  • B-cell linker
  • BLNK
  • BLNK-s
  • Cytoplasmic adapter protein
  • Ly57
  • MGC111051
  • SLP65
  • SLP-65BLNK-S
  • SLP65Ly57
  • Src homology 2 domain-containing leukocyte protein of 65 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF123
Species: Hu
Applications: WB, Block, ICC
NBP2-14356
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for BLNK Antibody (NBP2-14356) (0)

There are no publications for BLNK Antibody (NBP2-14356).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLNK Antibody (NBP2-14356) (0)

There are no reviews for BLNK Antibody (NBP2-14356). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BLNK Antibody (NBP2-14356) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BLNK Products

Bioinformatics Tool for BLNK Antibody (NBP2-14356)

Discover related pathways, diseases and genes to BLNK Antibody (NBP2-14356). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BLNK Antibody (NBP2-14356)

Discover more about diseases related to BLNK Antibody (NBP2-14356).
 

Pathways for BLNK Antibody (NBP2-14356)

View related products by pathway.

PTMs for BLNK Antibody (NBP2-14356)

Learn more about PTMs related to BLNK Antibody (NBP2-14356).
 

Research Areas for BLNK Antibody (NBP2-14356)

Find related products by research area.

Blogs on BLNK

There are no specific blogs for BLNK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BLNK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BLNK
Entrez