BLMH/Bleomycin Hydrolase Antibody

Images

 
Western Blot: BLMH/Bleomycin Hydrolase Antibody [NBP1-88640] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: BLMH/Bleomycin Hydrolase Antibody [NBP1-88640] - Staining of human skin shows moderate positivity in a subset of keratinocytes.
Western Blot: BLMH Antibody [NBP1-88640] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BLMH/Bleomycin Hydrolase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKEPEDGRLVQFLLMNPANDGGQWDMLVNIVEKYGVIPKKCFPESYTTEATRRMNDILNHKMREFCIRLRNLVHSGATKGEISATQDVMMEEIFRVVCICLGNP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BLMH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BLMH/Bleomycin Hydrolase Protein (NBP1-88640PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BLMH/Bleomycin Hydrolase Antibody

  • BHBMHBLM hydrolase
  • bleomycin hydrolase
  • BLMH
  • BMH
  • EC 3.4.22.40

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-88640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640) (0)

There are no publications for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640) (0)

There are no reviews for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BLMH/Bleomycin Hydrolase Products

Bioinformatics Tool for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640)

Discover related pathways, diseases and genes to BLMH/Bleomycin Hydrolase Antibody (NBP1-88640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640)

Discover more about diseases related to BLMH/Bleomycin Hydrolase Antibody (NBP1-88640).
 

Pathways for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640)

View related products by pathway.

PTMs for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640)

Learn more about PTMs related to BLMH/Bleomycin Hydrolase Antibody (NBP1-88640).
 

Research Areas for BLMH/Bleomycin Hydrolase Antibody (NBP1-88640)

Find related products by research area.

Blogs on BLMH/Bleomycin Hydrolase

There are no specific blogs for BLMH/Bleomycin Hydrolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BLMH/Bleomycin Hydrolase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BLMH
Entrez