GCH1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GCH1 Antibody [NBP1-84949] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
GCH1 Protein (NBP1-84949PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCH1 Antibody

  • dystonia 14
  • DYT14
  • DYT5a
  • DYT5EC 3.5.4.16
  • GCH
  • GTP cyclohydrolase 1
  • GTP cyclohydrolase I
  • GTPCH1
  • GTP-CH-1
  • GTP-CH-I
  • guanosine 5'-triphosphate cyclohydrolase I
  • HPABH4B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56137
Species: Hu
Applications: ICC/IF
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-88640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8038
Species: Hu, Mu, Rt
Applications: WB

Publications for GCH1 Antibody (NBP1-84949) (0)

There are no publications for GCH1 Antibody (NBP1-84949).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCH1 Antibody (NBP1-84949) (0)

There are no reviews for GCH1 Antibody (NBP1-84949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GCH1 Antibody (NBP1-84949). (Showing 1 - 1 of 1 FAQ).

  1. Do you sell this product at larger amount in one package at a lower price? Thanks. For example 200ul at $500
    • In regards to your inquiry about pricing for larger amounts unfortunately we do not provide that. We can provide bulk discounts for the purchase of multiple vials, but typically that starts at 10 or more vials. If you wish to contact bulk@novusbio.com they can provide a quote for large purchases. We also have promotions that you might find useful.

Secondary Antibodies

 

Isotype Controls

Additional GCH1 Products

Bioinformatics Tool for GCH1 Antibody (NBP1-84949)

Discover related pathways, diseases and genes to GCH1 Antibody (NBP1-84949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCH1 Antibody (NBP1-84949)

Discover more about diseases related to GCH1 Antibody (NBP1-84949).
 

Pathways for GCH1 Antibody (NBP1-84949)

View related products by pathway.

PTMs for GCH1 Antibody (NBP1-84949)

Learn more about PTMs related to GCH1 Antibody (NBP1-84949).

Blogs on GCH1

There are no specific blogs for GCH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCH1
Entrez
Uniprot