GCH1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GCH1 Antibody [NBP1-84949] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] -Staining of human pancreas shows strong cytoplasmic and nuclear positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] -Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GCH1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GCH1 Antibody - BSA Free (NBP1-84949) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GCH1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE
• Predicted Species: Mouse (93%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  GCH1 Protein (NBP1-84949PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GCH1 Antibody - BSA Free

• dystonia 14
• DYT14
• DYT5
• DYT5a
• DYT5EC 3.5.4.16
• GCH
• GCH1
• GTP cyclohydrolase 1
• GTP cyclohydrolase I
• GTPCH1
• GTP-CH-1
• GTP-CH-I
• guanosine 5'-triphosphate cyclohydrolase I
• HPABH4B

Background

GCH1 encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GCH1 Antibody (NBP1-84949)(1)

Publication using NBP1-84949

• Cronin SJF, Rao S, Tejada MA et al. Phenotypic drug screen uncovers the metabolic GCH1/BH4 pathway as key regulator of EGFR/KRAS-mediated neuropathic pain and lung cancer Science Translational Medicine 2022-08-31 [PMID: 36044597] (Western Blot)

FAQs for GCH1 Antibody (NBP1-84949). (Showing 1 - 1 of 1 FAQ).

1. Do you sell this product at larger amount in one package at a lower price? Thanks. For example 200ul at $500
   • In regards to your inquiry about pricing for larger amounts unfortunately we do not provide that. We can provide bulk discounts for the purchase of multiple vials, but typically that starts at 10 or more vials. If you wish to contact bulk@novusbio.com they can provide a quote for large purchases. We also have promotions that you might find useful.

Bioinformatics

• Gene Symbol: GCH1
• Entrez:
  • 2643(Human)
• Uniprot:
  • P30793(Human)