Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human BLIMP1/PRDM1 Protein [H00000639-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-109 of Human BLIMP1/PRDM1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PRDM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein

  • Beta-interferon gene positive regulatory domain I-binding factor
  • beta-interferon gene positive-regulatory domain I binding factor
  • BLIMP1
  • BLIMP-1
  • BLIMP1MGC118925
  • blmp-1
  • B-lymphocyte-induced maturation protein 1
  • MGC118922
  • MGC118923
  • Positive regulatory domain I-binding factor 1
  • PR domain containing 1, with ZNF domain
  • PR domain zinc finger protein 1
  • PR domain-containing protein 1
  • PRDI-BF1MGC118924
  • PRDI-binding factor 1
  • PRDI-binding factor-1
  • PRDM1
  • PR-domain zinc finger protein 1
  • ZNFPR1A1

Background

PRDM1 - PR domain containing 1, with ZNF domain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
MAB3487
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF5525
Species: Hu
Applications: IHC, WB
6507-IL/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-89644
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF594
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
NBP1-91011
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
M6000B
Species: Mu
Applications: ELISA
M5000
Species: Mu
Applications: ELISA
H00000639-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for BLIMP1/PRDM1 Partial Recombinant Protein (H00000639-Q01) (0)

There are no publications for BLIMP1/PRDM1 Partial Recombinant Protein (H00000639-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLIMP1/PRDM1 Partial Recombinant Protein (H00000639-Q01) (0)

There are no reviews for BLIMP1/PRDM1 Partial Recombinant Protein (H00000639-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BLIMP1/PRDM1 Partial Recombinant Protein (H00000639-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Will this protein bind DNA? I would like to use it in gel-shift assays. It says it comprises zinc finger domain, amino acids 1-110, but unclear to me if it can bind DNA.
    • This product is produced by a Taiwanese company called Abnova and we distribute it for them. We do no in-house testing or development of their products. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-transnational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody. While some of their proteins do show biological activity, unfortunately, because they are not directly tested for this, there is no way to predict whether or not this particular product shows biological activity.

Additional BLIMP1/PRDM1 Products

Research Areas for BLIMP1/PRDM1 Partial Recombinant Protein (H00000639-Q01)

Find related products by research area.

Blogs on BLIMP1/PRDM1.

Tired T cells: Hypoxia Drives T cell Exhaustion in the Tumor Microenvironment
By Hunter MartinezThe paradigm shifting view of the immune system being leveraged to target cancer has led to numerous therapeutic breakthroughs. One major cell group responsible for this revelation is a T cell. ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BLIMP1/PRDM1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM1