BIRC6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BIRC6 Antibody [NBP2-57759] - Staining of human cell line A549 shows localization to the Golgi apparatus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BIRC6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BIRC6 Antibody - BSA Free (NBP2-57759) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BIRC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BIRC6 Recombinant Protein Antigen (NBP2-57759PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BIRC6 Antibody - BSA Free

• APOLLON
• baculoviral IAP repeat containing 6
• baculoviral IAP repeat-containing 6
• baculoviral IAP repeat-containing protein 6
• BIRC6
• BRUCE
• EC 2.3.2.27
• FLJ13786
• KIAA1289
• KIAA1289FLJ13726
• Ubiquitin-conjugating BIR domain enzyme apollon
• ubiquitin-conjugating BIR-domain enzyme apollon

Background

BIRC6 encodes a protein with a BIR (baculoviral inhibition of apoptosis protein repeat) domain and a UBCc (ubiquitin-conjugating enzyme E2, catalytic) domain. This protein inhibits apoptosis by facilitating the degradation of apoptotic proteins by ubiquitination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BIRC6