BID Antibody

Images

 
Western Blot: BID Antibody [NBP1-86187] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. ...read more
Immunocytochemistry/ Immunofluorescence: BID Antibody [NBP1-86187] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: BID Antibody [NBP1-86187] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BID Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BID
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BID Protein (NBP1-86187PEP)
Publications
Read Publications using NBP1-86187.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19363473)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BID Antibody

  • apoptic death agonist
  • BH3 interacting domain death agonist
  • BH3-interacting domain death agonist
  • BID isoform ES(1b)
  • BID isoform L(2)
  • BID isoform Si6
  • BID
  • desmocollin type 4
  • FP497
  • Human BID coding sequence
  • MGC15319
  • MGC42355
  • p22 BID

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-86187
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BID Antibody (NBP1-86187)(3)

Reviews for BID Antibody (NBP1-86187) (0)

There are no reviews for BID Antibody (NBP1-86187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BID Antibody (NBP1-86187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BID Products

Bioinformatics Tool for BID Antibody (NBP1-86187)

Discover related pathways, diseases and genes to BID Antibody (NBP1-86187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BID Antibody (NBP1-86187)

Discover more about diseases related to BID Antibody (NBP1-86187).
 

Pathways for BID Antibody (NBP1-86187)

View related products by pathway.

PTMs for BID Antibody (NBP1-86187)

Learn more about PTMs related to BID Antibody (NBP1-86187).
 

Research Areas for BID Antibody (NBP1-86187)

Find related products by research area.

Blogs on BID.

Apoptosis and Necroptosis Part I: Important factors to identify both types of programmed cell death
Different types of cell death have classically been identified by discrete morphological changes. The hallmarks of apoptosis include cell shrinkage, nuclear fragmentation and membrane blebbing whereas necroptosis is characterized by cell swelling...  Read full blog post.

The use of apoptosis antibodies and controls in cell death research
Apoptosis is a method of programmed cell death that is notably characterized by a morphological change in cellular nuclei and membrane appearance.  Not to be confused with necrosis, apoptosis is a pathway that is induced by a variety of factors tha...  Read full blog post.

The role of p53 in UV radiation DNA damage and subsequent tumorogenesis
p53, the protein product of the tp53 gene, is one of the most widely studied tumor suppressor proteins in cancer research.  p53 is unique in that it demonstrates both tumor suppressive and tumor progressive properties depending on whether it is fu...  Read full blog post.

active/cleaved Caspase 2 - Inducing apoptosis in response to cellular stress
Caspase-2 is a highly conserved member of the caspase family involved in the initiation and execution of apoptosis. While its function is still poorly understood, caspase-2 is thought to be important for apoptosis in response to DNA damage, bacteri...  Read full blog post.

Bcl-2 - an antiapoptotic protein with an important role in cancer cell survival
B-cell lymphoma 2 (Bcl-2) protein is an oncogene that normally acts as an apoptotic inhibitor and localizes to the mitochondrial membrane where it prevents the release of cytochrome c. The Bcl-2 protein family consists of over 20 proteins each co...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BID Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BID
Entrez