| Description | Novus Biologicals Rabbit BID Antibody - BSA Free (NBP1-86187) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BID Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.  | 
        
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR  | 
        
| Isotype | IgG  | 
        
| Clonality | Polyclonal  | 
        
| Host | Rabbit  | 
        
| Gene | BID  | 
        
| Purity | Immunogen affinity purified  | 
        
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase.  | 
        
| Dilutions | 
                                      
  | 
                              ||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.  | 
        ||
| Control Peptide | 
                                                
  | 
                                        ||
| Publications | 
                                            
  | 
                                    
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.  | 
        
| Buffer | PBS (pH 7.2) and 40% Glycerol  | 
        
| Preservative | 0.02% Sodium Azide  | 
        
| Purity | Immunogen affinity purified  | 
        
                Secondary Antibodies | 
                Isotype Controls | 
Research Areas for BID Antibody (NBP1-86187)Find related products by research area. 
                      | 
| 
                                    Apoptosis and Necroptosis Part I: Important factors to identify both types of programmed cell death  Different types of cell death have classically been identified by discrete morphological changes. The hallmarks of apoptosis include cell shrinkage, nuclear fragmentation and membrane blebbing whereas necroptosis is characterized by cell swelling ... Read full blog post.  | 
                            
| 
                                    The use of apoptosis antibodies and controls in cell death research Apoptosis is a method of programmed cell death that is notably characterized by a morphological change in cellular nuclei and membrane appearance. Not to be confused with necrosis, apoptosis is a pathway that is induced by a variety of factors tha... Read full blog post.  | 
                            
| 
                                    The role of p53 in UV radiation DNA damage and subsequent tumorogenesis p53, the protein product of the tp53 gene, is one of the most widely studied tumor suppressor proteins in cancer research. p53 is unique in that it demonstrates both tumor suppressive and tumor progressive properties depending on whether it is fu... Read full blog post.  | 
                            
| 
                                    active/cleaved Caspase 2 - Inducing apoptosis in response to cellular stress Caspase-2 is a highly conserved member of the caspase family involved in the initiation and execution of apoptosis. While its function is still poorly understood, caspase-2 is thought to be important for apoptosis in response to DNA damage, bacteri... Read full blog post.  | 
                            
| 
                                    Bcl-2 - an antiapoptotic protein with an important role in cancer cell survival B-cell lymphoma 2 (Bcl-2) protein is an oncogene that normally acts as an apoptotic inhibitor and localizes to the mitochondrial membrane where it prevents the release of cytochrome c. The Bcl-2 protein family consists of over 20 proteins each co... Read full blog post.  | 
                            
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BID |